1UGH: Human uracil-DNA glycosylase

Name: PDB 1UGH: Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA
Published: 1999-02-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: glycosylase

Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA. Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Feb 1999.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Homo sapiens, Bacillus phage PBS2
Chains: 2
Atoms: 2,640
Mol. weight: 34.79 kDa
Released: 16 Feb 1999

Explore 1UGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UGH contains 17 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 15 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	87-93	7
α-helix	94-96	3
α-helix	100-115	16
β-strand	118-119	2	1
α-helix	122-124	3
α-helix	127-131	5
α-helix	134-136	3
β-strand	139-143	5	2
α-helix	146-147	2
α-helix	165-167	3
α-helix	168-180	13
α-helix	193-196	4
β-strand	200-204	5	2
β-strand	209-210	2	1
β-strand	213	1	1
α-helix	222-236	15
β-strand	241-245	5	2
α-helix	247-252	6
β-strand	262-266	5	2
α-helix	274-276	3
α-helix	283-294	12
α-helix	297-299	3

Chain I: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	18-24	7	3
α-helix	26-33	8
β-strand	41-48	8	3
β-strand	53-60	8	3
β-strand	69-73	5	3
β-strand	79-83	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (uracil-DNA glycosylase)	E	protein	223	Homo sapiens	P13051 (AlphaFold model)
Protein (uracil-DNA glycosylase inhibitor)	I	protein	82	Bacillus phage PBS2	P14739 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>1UGH_1 PROTEIN (URACIL-DNA GLYCOSYLASE) (chains E)
MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVI
LGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL
LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRH
HVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

Sequence of entity 2 (I), FASTA

>1UGH_2 PROTEIN (URACIL-DNA GLYCOSYLASE INHIBITOR) (chains I)
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDA
PEYKPWALVIQDSNGENKIKML

Primary citation

Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA. Mol, C.D., Arvai, A.S., Sanderson, R.J. et al. Cell (1995) 82:701-708. DOI 10.1016/0092-8674(95)90467-0 · PubMed

Other PDB entries of the same protein (UniProt P13051 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FCI 1.27 Å, Complex of UNG2 and a fragment-based designed inhibitor
2HXM 1.3 Å, Complex of UNG2 and a small Molecule synthetic Inhibitor
3TKB 1.5 Å, crystal structure of human uracil-DNA glycosylase D183G/K302R mutant
1AKZ 1.57 Å, Human uracil-DNA glycosylase
3FCK 1.64 Å, Complex of UNG2 and a fragment-based design inhibitor
3FCL 1.7 Å, Complex of UNG2 and a fragment-based designed inhibitor
9LNQ 1.74 Å, The hUNG bound to DNA product embedding 4primer-OCH3-dU
9LNP 1.76 Å, the hUNG bound to DNA product embedding uridine ribonucleotide
1EMH 1.8 Å, Crystal structure of human uracil-DNA glycosylase bound to uncleaved…
6VBA 1.8 Å, Structure of human Uracil DNA Glycosylase (UDG) bound to Aurintricarboxylic acid (ATA)
3FCF 1.84 Å, Complex of UNG2 and a fragment-based designed inhibitor
1Q3F 1.9 Å, Uracil DNA glycosylase bound to a cationic 1-aza-2'-deoxyribose-containing DNA

Browse structure collections

About this viewer

MolViewer shows 1UGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.