Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]. Determined by solution NMR. Released 28 Dec 2003.
Explore 1UHC in 3D Show helices and sheets RCSB PDB PDBe
1UHC contains 1 α-helix and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-18 | 3 | 1 |
| β-strand | 22 | 1 | 2 |
| β-strand | 29 | 1 | 3 |
| β-strand | 32 | 1 | 2 |
| β-strand | 37-38 | 2 | 1 |
| β-strand | 39-42 | 4 | 3 |
| β-strand | 52-56 | 5 | 3 |
| β-strand | 61-65 | 5 | 3 |
| α-helix | 66-68 | 3 | |
| β-strand | 69-71 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| KIAA1010 protein | A | protein | 79 | Homo sapiens | Q6XZF7 (AlphaFold model) |
>1UHC_1 KIAA1010 protein (chains A) GSSGSSGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGK KGYVPSNYIRKTESGPSSG
Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]. Abe, T., Hirota, H., Kobayashi, N. et al. To be published.
Other PDB entries of the same protein (UniProt Q6XZF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1UHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.