1UHL: LXRalfa-RXRbeta LBD heterodimer

Crystal structure of the LXRalfa-RXRbeta LBD heterodimer. Determined by X-ray diffraction at 2.9 Å resolution. Released 1 Jun 2004.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,707
Mol. weight: 57.62 kDa
Ligands: 444, MEI
Released: 1 Jun 2004

Explore 1UHL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UHL contains 24 α-helices and 5 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	301-310	10
α-helix	335-355	21
α-helix	360-362	3
α-helix	365-386	22
β-strand	394-396	3	1
β-strand	402-404	3	1
α-helix	405-411	7
α-helix	414-419	6
α-helix	420-425	6
α-helix	426-430	5
α-helix	435-446	12
α-helix	457-478	22
α-helix	485-513	29
α-helix	520-525	6

Chain B: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	208-224	17
α-helix	253-274	22
α-helix	283-303	21
β-strand	306-307	2	2
β-strand	312-313	2	2
β-strand	321	1	2
α-helix	323-326	4
α-helix	336-349	14
α-helix	353-364	12
α-helix	375-396	22
α-helix	403-408	6
α-helix	410-429	20
α-helix	437-442	6

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	606-611	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoic acid receptor RXR-beta	A	protein	236	Homo sapiens	P28702 (AlphaFold model)
Oxysterols receptor LXR-alpha	B	protein	242	Homo sapiens	Q13133 (AlphaFold model)
10-mer peptide from Nuclear receptor coactivator 2	C, D	protein	10		Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UHL_1 Retinoic acid receptor RXR-beta (chains A)
EMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRI
PHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIF
DRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQ
KYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA

Sequence of entity 2 (B), FASTA

>1UHL_2 Oxysterols receptor LXR-alpha (chains B)
MSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSV
QEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNRED
FAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTY
VEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV
HE

Sequence of entity 3 (C, D), FASTA

>1UHL_3 10-mer peptide from Nuclear receptor coactivator 2 (chains C, D)
HKILHRLLQD

Ligands and cofactors

ID	Name	Formula	Copies
444	N-(2,2,2-trifluoroethyl)-N-{4-[2,2,2-trifluoro-1-hydroxy-1-(trifluoromethyl)eth…	C17 H12 F9 N O3 S	1
MEI	(2E,4E)-11-methoxy-3,7,11-trimethyldodeca-2,4-dienoic acid	C16 H28 O3	1

Primary citation

Crystal structure of the heterodimeric complex of LXRalpha and RXRbeta ligand-binding domains in a fully agonistic conformation. Svensson, S., Ostberg, T., Jacobsson, M. et al. EMBO J (2003) 22:4625-4633. DOI 10.1093/emboj/cdg456 · PubMed

Other PDB entries of the same protein (UniProt P28702 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A78 1.72 Å, Crystal structure of RXR beta LBD in complexes with palmitic acid and GRIP-1 peptide
5KYA 2.6 Å, Brain penetrant liver X receptor (LXR) modulators based on a…
5HJP 2.6 Å, Identification of LXRbeta selective agonists for the treatment of Alzheimer's Disease
5I4V 2.61 Å, Discovery of novel, orally efficacious Liver X Receptor (LXR) beta agonists
1H9U 2.7 Å, The structure of the human retinoid-X-receptor beta ligand binding domain in complex…
5KYJ 2.8 Å, Brain penetrant liver X receptor (LXR) modulators based on a…

Browse structure collections

About this viewer

MolViewer shows 1UHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.