7A78: Retinoic acid receptor RXR-beta

Crystal structure of RXR beta LBD in complexes with palmitic acid and GRIP-1 peptide. Determined by X-ray diffraction at 1.72 Å resolution. Released 21 Oct 2020.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,977
Mol. weight: 28.79 kDa
Ligands: PLM
Released: 21 Oct 2020

Explore 7A78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7A78 contains 14 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	301-310	10
α-helix	335-355	21
α-helix	360-362	3
α-helix	365-387	23
β-strand	394-396	3	1
β-strand	402-404	3	1
α-helix	405-410	6
α-helix	414-420	7
α-helix	421-425	5
α-helix	426-431	6
α-helix	435-446	12
α-helix	457-478	22
α-helix	485-490	6
α-helix	493-513	21
α-helix	520-525	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	473-480	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoic acid receptor RXR-beta	A	protein	238	Homo sapiens	P28702 (AlphaFold model)
Nuclear receptor coactivator 2	B	protein	14	Homo sapiens	Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7A78_1 Retinoic acid receptor RXR-beta (chains A)
SMEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAK
RIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGA
IFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYC
KQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA

Sequence of entity 2 (B), FASTA

>7A78_2 Nuclear receptor coactivator 2 (chains B)
KHKILHRLLQDSSY

Ligands and cofactors

ID	Name	Formula	Copies
PLM	Palmitic acid	C16 H32 O2	1

Water and common crystallization additives (CL, EDO) are not listed.

Primary citation

Comprehensive Set of Tertiary Complex Structures and Palmitic Acid Binding Provide Molecular Insights into Ligand Design for RXR Isoforms. Chaikuad, A., Pollinger, J., Ruhl, M. et al. Int J Mol Sci (2020) 21. DOI 10.3390/ijms21228457 · PubMed

Other PDB entries of the same protein (UniProt P28702 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KYA 2.6 Å, Brain penetrant liver X receptor (LXR) modulators based on a…
5HJP 2.6 Å, Identification of LXRbeta selective agonists for the treatment of Alzheimer's Disease
5I4V 2.61 Å, Discovery of novel, orally efficacious Liver X Receptor (LXR) beta agonists
1H9U 2.7 Å, The structure of the human retinoid-X-receptor beta ligand binding domain in complex…
5KYJ 2.8 Å, Brain penetrant liver X receptor (LXR) modulators based on a…
1UHL 2.9 Å, Crystal structure of the LXRalfa-RXRbeta LBD heterodimer

Browse structure collections

About this viewer

MolViewer shows 7A78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.