1UYM: Heat shock protein hsp 90-beta

Human Hsp90-beta with PU3 (9-Butyl-8(3,4,5-trimethoxy-benzyl)-9H-purin-6-ylamine). Determined by X-ray diffraction at 2.45 Å resolution. Released 17 Aug 2004.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,832
Mol. weight: 25.04 kDa
Ligands: PU3
Released: 17 Aug 2004

Explore 1UYM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UYM contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	1
α-helix	22-23	2
α-helix	24-35	12
α-helix	43-62	20
α-helix	67-70	4
β-strand	78-83	6	1
β-strand	88-93	6	1
α-helix	100-101	2
α-helix	102-106	5
α-helix	107-122	16
α-helix	128-134	7
α-helix	137-143	7
β-strand	145-153	9	1
β-strand	160-164	5	1
β-strand	169-174	6	1
β-strand	183-190	8	1
α-helix	192-198	7
α-helix	200-210	11
β-strand	218-220	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein hsp 90-beta	A	protein	220	HOMO SAPIENS	P08238 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UYM_1 HEAT SHOCK PROTEIN HSP 90-BETA (chains A)
PEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTD
PSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGA
DISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKV
ILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKER

Ligands and cofactors

ID	Name	Formula	Copies
PU3	9-butyl-8-(3,4,5-trimethoxybenzyl)-9H-purin-6-amine	C19 H25 N5 O3	1

Primary citation

Structure-Activity Relationships in Purine-Based Inhibitor Binding to Hsp90 Isoforms. Wright, L., Barril, X., Dymock, B. et al. Chem Biol (2004) 11:775. DOI 10.1016/J.CHEMBIOL.2004.03.033 · PubMed

Other PDB entries of the same protein (UniProt P08238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D9I 1.5 Å, Human Hsp90b nucleotide binding domain in complex with BRI2312
6N8Y 1.55 Å, Hsp90-beta bound to PU-11-trans
5UCJ 1.69 Å, Hsp90b N-terminal domain with inhibitors
7ULJ 1.82 Å, Hsp90b N-terminal domain in complex with 42C
9D9H 1.96 Å, Human Hsp90b nucleotide binding domain in complex with BRI2311
5UC4 2.05 Å, Hsp90b N-terminal domain with inhibitors
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
3NMQ 2.2 Å, Hsp90b N-terminal domain in complex with EC44, a pyrrolo-pyrimidine methoxypyridine…
3PRY 2.28 Å, Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution
3UQ3 2.6 Å, TPR2AB-domain:pHSP90-complex of yeast Sti1
9W5I 2.63 Å, AGO maturation complex (AMC): AGO2-miRNA duplex in complex with Hsp90 beta and…
5UCH 2.65 Å, Hsp90b N-terminal domain with inhibitors

Browse structure collections

About this viewer

MolViewer shows 1UYM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.