Family 11 Carbohydrate-Binding Module of cellulosomal cellulase Lic26A-Cel5E of Clostridium thermocellum. Determined by X-ray diffraction at 1.98 Å resolution. Released 12 Jan 2005.
Explore 1V0A in 3D Show helices and sheets RCSB PDB PDBe
1V0A contains 2 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| β-strand | 7-11 | 5 | 2 |
| β-strand | 20-24 | 5 | 3 |
| β-strand | 28-35 | 8 | 2 |
| β-strand | 40-47 | 8 | 2 |
| β-strand | 53-59 | 7 | 3 |
| β-strand | 70-77 | 8 | 2 |
| β-strand | 85-92 | 8 | 3 |
| α-helix | 93 | 1 | |
| β-strand | 99-107 | 9 | 3 |
| β-strand | 114-119 | 6 | 2 |
| α-helix | 120-122 | 3 | |
| β-strand | 124-125 | 2 | 3 |
| β-strand | 145-152 | 8 | 3 |
| β-strand | 158-168 | 11 | 2 |
| β-strand | 170 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endoglucanase H | A | protein | 178 | CLOSTRIDIUM THERMOCELLUM | P16218 (AlphaFold model) |
>1V0A_1 ENDOGLUCANASE H (chains A) MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSL PDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPF SSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (SO4) are not listed.
The Family 11 Carbohydrate-Binding Module of Clostridium Thermocellum Lic26A-Cel5E Accomodates Beta-1,4- and Beta-1,3-1,4-Mixed Linked Glucans at a Single Binding Site. Carvalho, A.L., Goyal, A., Prates, J.A.M. et al. J Biol Chem (2004) 279:34785. DOI 10.1074/JBC.M405867200 · PubMed
Other PDB entries of the same protein (UniProt P16218 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1V0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.