1V0A: Endoglucanase H

Family 11 Carbohydrate-Binding Module of cellulosomal cellulase Lic26A-Cel5E of Clostridium thermocellum. Determined by X-ray diffraction at 1.98 Å resolution. Released 12 Jan 2005.

Method: X-ray diffraction
Resolution: 1.98 Å
Organism: CLOSTRIDIUM THERMOCELLUM
Chains: 1
Atoms: 1,527
Mol. weight: 20.35 kDa
Ligands: CA
Released: 12 Jan 2005

Explore 1V0A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1V0A contains 2 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	7-11	5	2
β-strand	20-24	5	3
β-strand	28-35	8	2
β-strand	40-47	8	2
β-strand	53-59	7	3
β-strand	70-77	8	2
β-strand	85-92	8	3
α-helix	93	1
β-strand	99-107	9	3
β-strand	114-119	6	2
α-helix	120-122	3
β-strand	124-125	2	3
β-strand	145-152	8	3
β-strand	158-168	11	2
β-strand	170	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endoglucanase H	A	protein	178	CLOSTRIDIUM THERMOCELLUM	P16218 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1V0A_1 ENDOGLUCANASE H (chains A)
MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSL
PDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPF
SSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

The Family 11 Carbohydrate-Binding Module of Clostridium Thermocellum Lic26A-Cel5E Accomodates Beta-1,4- and Beta-1,3-1,4-Mixed Linked Glucans at a Single Binding Site. Carvalho, A.L., Goyal, A., Prates, J.A.M. et al. J Biol Chem (2004) 279:34785. DOI 10.1074/JBC.M405867200 · PubMed

Other PDB entries of the same protein (UniProt P16218 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V3G 1.2 Å, Structure of a family 26 lichenase in complex with noeuromycin
2CIP 1.4 Å, Structure of the Michaelis complex of a family 26 lichenase
2CIT 1.4 Å, Structure of the covalent intermediate of a family 26 lichenase
6R3M 1.45 Å, Family 11 Carbohydrate-Binding Module from Clostridium thermocellum in complex with…
2BV9 1.5 Å, How family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides.…
2VI0 1.51 Å, Lichenase CtLic26 in complex with a thio-oligosaccharide
2BVD 1.6 Å, How family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides.…
4U3A 2.42 Å, Crystal structure of CtCel5E
4U5I 2.5 Å, Complex structure of mutant CtCel5E (E314A) with xylobiose
5BYW 2.6 Å, Crystal structure of engineered trifunctional CtCEL5E
6R31 2.6 Å, Family 11 Carbohydrate-Binding Module from Clostridium thermocellum in complex with…
4U5K 2.65 Å, Complex structure of mutant CtCel5E (E314A) with cellobiose

Browse structure collections

About this viewer

MolViewer shows 1V0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.