1V5H: Human Cytoglobin

Crystal Structure of Human Cytoglobin (Ferric Form). Determined by X-ray diffraction at 2.4 Å resolution. Released 8 Jun 2004.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,293
Mol. weight: 22.33 kDa
Ligands: HEM
Released: 8 Jun 2004

Explore 1V5H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1V5H contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	23-34	12
α-helix	41-52	12
α-helix	54-57	4
α-helix	69-74	6
α-helix	76-94	19
α-helix	99-112	14
α-helix	113-117	5
α-helix	122-138	17
α-helix	147-169	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoglobin	A	protein	193	Homo sapiens	Q8WWM9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1V5H_1 Cytoglobin (chains A)
GSHMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAK
QYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKH
KVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPN
ATTPPATLPSSGP

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1

Primary citation

Structural basis of human cytoglobin for ligand binding. Sugimoto, H., Makino, M., Sawai, H. et al. J Mol Biol (2004) 339:873-885. DOI 10.1016/j.jmb.2004.04.024 · PubMed

Other PDB entries of the same protein (UniProt Q8WWM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DC3 1.68 Å, Crystal structure of human cytoglobin at 1.68 angstroms resolution
1URV 2.0 Å, Crystal structure of cytoglobin: the fourth globin type discovered in man displays heme…
1UT0 2.1 Å, Crystal structure of cytoglobin: the fourth globin type discovered in man displays heme…
1URY 2.4 Å, cytoglobin cavities
1UX9 2.4 Å, Mapping protein matrix cavities in human cytoglobin through Xe atom binding: a…
1UMO 2.59 Å, The crystal structure of cytoglobin: the fourth globin type discovered in man
3AG0 2.6 Å, Crystal structure of carbonmonoxy human cytoglobin
4B3W 2.8 Å, Crystal structure of human cytoglobin H(E7)Q mutant

Browse more

1V5H is part of these collections:

Hemoglobin and oxygen transport

About this viewer

MolViewer shows 1V5H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.