1VMP: Anti-HIV chemokine vmip-II

Structure of the anti-HIV chemokine vmip-II. Determined by solution NMR. Released 24 Nov 1999.

Method: Solution NMR
Organism: Human herpesvirus 8
Chains: 1
Atoms: 570
Mol. weight: 8.14 kDa
Released: 24 Nov 1999

Explore 1VMP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VMP contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	25-27	3
β-strand	28-34	7	1
α-helix	35	1
β-strand	42-47	6	1
β-strand	52-53	2	1
β-strand	56	1	1
α-helix	60-68	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (anti-HIV chemokine mip VII)	A	protein	71	Human herpesvirus 8	Q98157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1VMP_1 PROTEIN (ANTI-HIV CHEMOKINE MIP VII) (chains A)
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVK
KLMQQLPVTAR

Primary citation

The solution structure of the anti-HIV chemokine vMIP-II. Liwang, A.C., Wang, Z.X., Sun, Y. et al. Protein Sci (1999) 8:2270-2280. PubMed

Other PDB entries of the same protein (UniProt Q98157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FHT 1.7 Å, Crystal Structure of Viral Macrophage Inflammatory Protein-II
1CM9 2.1 Å, Crystal structure of viral macrophage inflammatory protein-II
2FJ2 2.3 Å, Crystal Structure of Viral Macrophage Inflammatory Protein-II
4RWS 3.1 Å, Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community…
1HFF NMR solution structures of the vMIP-II 1-10 peptide from Kaposi's sarcoma-associated…
1HFG NMR solution structure of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus…
1HFN NMR solution structures of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus.
1HHV Solution structure of virus chemokine vmip-II

Browse structure collections

About this viewer

MolViewer shows 1VMP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.