1WCR: PDB entry 1WCR

Name: PDB 1WCR: Trimeric Structure of the Enzyme IIA from Escherichia coli Phosphotransferase System Specific for N,N'-Diacetylchitobiose
Published: 2005-01-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Trimeric Structure of the Enzyme IIA from Escherichia coli Phosphotransferase System Specific for N,N'-Diacetylchitobiose. Determined by solution NMR. Released 19 Jan 2005.

Method: Solution NMR
Organism: ESCHERICHIA COLI
Chains: 3
Atoms: 2,349
Mol. weight: 33.77 kDa
Released: 19 Jan 2005

Explore 1WCR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WCR contains 9 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-30	29
α-helix	34-61	28
α-helix	72-101	30

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-30	29
α-helix	34-61	28
α-helix	72-100	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pts system, N, N'-diacetylchitobiose-specific iia component	A, B, C	protein	103	ESCHERICHIA COLI	P69791 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1WCR_1 PTS SYSTEM, N, N'-DIACETYLCHITOBIOSE-SPECIFIC IIA COMPONENT (chains A, B, C)
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIE
GDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA

Primary citation

Solution Structure of Enzyme Iiachitobiose from the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransferase System. Tang, C., Williams, D.C., Ghirlando, R. et al. J Biol Chem (2005) 280:11770. DOI 10.1074/JBC.M414300200 · PubMed

Other PDB entries of the same protein (UniProt P69791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2LRK Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose
2LRL Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose…
2WWV NMR structure of the IIAchitobiose-IIBchitobiose complex of the N,N'- diacetylchitoboise…
2WY2 NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of…

Browse structure collections

About this viewer

MolViewer shows 1WCR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.