2LRL: PDB entry 2LRL

Name: PDB 2LRL: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System
Published: 2012-05-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System. Determined by solution NMR. Released 16 May 2012.

Method: Solution NMR
Organism: Escherichia coli
Chains: 4
Atoms: 2,993
Mol. weight: 42.98 kDa
Ligands: PO3
Released: 16 May 2012

Explore 2LRL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LRL contains 12 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-30	27
α-helix	34-60	27
α-helix	72-102	31

Chain D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	302-307	6	1
α-helix	316-327	12
β-strand	332-337	6	1
β-strand	340-343	4	1
α-helix	347-350	4
β-strand	360-366	7	1
α-helix	370-383	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component	A, B, C	protein	103	Escherichia coli	P69791 (AlphaFold model)
Phosphocarrier protein HPr	D	protein	85	Escherichia coli	P0AA04 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2LRL_1 N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component (chains A, B, C)
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIE
GDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA

Sequence of entity 2 (D), FASTA

>2LRL_2 Phosphocarrier protein HPr (chains D)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Ligands and cofactors

ID	Name	Formula	Copies
PO3	Phosphite ion	O3 P	1

Primary citation

Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System. Jung, Y.S., Cai, M., Clore, G.M. J Biol Chem (2012) 287:23819-23829. DOI 10.1074/jbc.M112.371492 · PubMed

Other PDB entries of the same protein (UniProt P69791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WCR Trimeric Structure of the Enzyme IIA from Escherichia coli Phosphotransferase System…
2LRK Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose
2WWV NMR structure of the IIAchitobiose-IIBchitobiose complex of the N,N'- diacetylchitoboise…
2WY2 NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of…

Browse structure collections

About this viewer

MolViewer shows 2LRL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.