1WF6: Similar to S.pombe -rad4+/cut5+product

The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product. Determined by solution NMR. Released 26 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,021
Mol. weight: 14.55 kDa
Released: 26 Nov 2004

Explore 1WF6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WF6 contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	23-25	3
α-helix	31-33	3
β-strand	45-49	5	1
α-helix	54-65	12
β-strand	69-71	3	1
β-strand	80-83	4	1
α-helix	89-96	8
β-strand	103-105	3	1
α-helix	106-115	10
α-helix	122-124	3
β-strand	125	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Similar to S.pombe -rad4+/cut5+product (A40727)	A	protein	132	Homo sapiens	Q92547 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WF6_1 Similar to S.pombe -rad4+/cut5+product (A40727) (chains A)
GSSGSSGSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLDGCRIYLCGFSGRKLDKLR
RLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVVGAKWLLECFSKGYMLS
EEPYIHSGPSSG

Primary citation

The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product. Nagashima, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt Q92547 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PD7 1.26 Å, Crystal Structure of the Sixth BRCT Domain of Human TopBP1
3JVE 1.34 Å, Crystal Structure of the Sixth BRCT Domain of TopBP1
9MAT 1.65 Å, TopBP1 BRCT 7-8 Domain
7CMZ 1.7 Å, Crystal Structure of BRCT7/8 in Complex with the APS Motif of PHF8
3UEN 1.9 Å, Crystal structure of TopBP1 BRCT4/5 domains
3AL2 2.0 Å, Crystal Structure of TopBP1 BRCT7/8
3AL3 2.15 Å, Crystal Structure of TopBP1 BRCT7/8-BACH1 peptide complex
3OLC 2.4 Å, Crystal structure of the N-terminal region of TopBP1
9MAW 2.45 Å, Crystal structure of TOPBP1BRCT7-8 domain in complex with 1-Adamantaneacetic acid
2XNK 2.6 Å, Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor…
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide
2XNH 2.8 Å, Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor…

Browse structure collections

About this viewer

MolViewer shows 1WF6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.