Solution structure of the CS domain of human USP19. Determined by solution NMR. Released 28 Nov 2004.
Explore 1WH0 in 3D Show helices and sheets RCSB PDB PDBe
1WH0 contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-13 | 3 | |
| β-strand | 15-17 | 3 | 1 |
| β-strand | 22-27 | 6 | 2 |
| β-strand | 31-37 | 7 | 2 |
| β-strand | 41 | 1 | 3 |
| β-strand | 47-50 | 4 | 1 |
| β-strand | 54-59 | 6 | 1 |
| β-strand | 61 | 1 | 3 |
| α-helix | 64-69 | 6 | |
| β-strand | 79-84 | 6 | 1 |
| β-strand | 85 | 1 | 4 |
| β-strand | 89-98 | 10 | 2 |
| β-strand | 102-109 | 8 | 2 |
| β-strand | 119 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin carboxyl-terminal hydrolase 19 | A | protein | 134 | Homo sapiens | O94966 (AlphaFold model) |
>1WH0_1 Ubiquitin carboxyl-terminal hydrolase 19 (chains A) GSSGSSGVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQ TRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEA PAARVGGASGPSSG
Solution structure of the CS domain of human USP19. Nakanishi, T., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt O94966 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WH0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.