6KHV: CS2 Domain of USP19

Solution Structure of the CS2 Domain of USP19. Determined by solution NMR. Released 22 Jul 2020.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 937
Mol. weight: 13.34 kDa
Released: 22 Jul 2020

Explore 6KHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KHV contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	280-281	2	1
β-strand	287-291	5	2
β-strand	296-302	7	2
β-strand	306	1	3
β-strand	312-315	4	1
β-strand	319-324	6	1
β-strand	326	1	3
α-helix	329-334	6
β-strand	344-349	6	1
α-helix	356-358	3
β-strand	360-363	4	2
β-strand	367-373	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 19	A	protein	114	Homo sapiens	O94966 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KHV_1 Ubiquitin carboxyl-terminal hydrolase 19 (chains A)
VDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFL
RLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAP

Primary citation

Domain interactions reveal auto-inhibition of the deubiquitinating enzyme USP19 and its activation by HSP90 in the modulation of huntingtin aggregation. Xue, W., Zhang, S.X., He, W.T. et al. Biochem J (2020) 477:4295-4312. DOI 10.1042/BCJ20200536 · PubMed

Other PDB entries of the same protein (UniProt O94966 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4X3G 2.34 Å, Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
1WH0 Solution structure of the CS domain of human USP19
6K7W Solution Structure of the CS1 Domain of USP19
6KQV Solution Structure of the UbL Domain of USP19

Browse structure collections

About this viewer

MolViewer shows 6KHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.