Solution Structure of the UbL Domain of USP19. Determined by solution NMR. Released 19 Aug 2020.
Explore 6KQV in 3D Show helices and sheets RCSB PDB PDBe
6KQV contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 682-687 | 6 | 1 |
| α-helix | 696 | 1 | |
| β-strand | 697-702 | 6 | 1 |
| α-helix | 711-720 | 10 | |
| α-helix | 725-727 | 3 | |
| β-strand | 731-732 | 2 | 2 |
| β-strand | 733 | 1 | 3 |
| β-strand | 739 | 1 | 3 |
| β-strand | 757-758 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin carboxyl-terminal hydrolase 19 | A | protein | 88 | Homo sapiens | O94966 (AlphaFold model) |
>6KQV_1 Ubiquitin carboxyl-terminal hydrolase 19 (chains A) KQKVLPVFYFAREPHSKPIKFLVSVSKENSTASEVLDSLSQSVHVKPENLRLAEVIKNRF HRVFLPSHSLDTVSPSDTLLCFELLSSE
Domain interactions reveal auto-inhibition of the deubiquitinating enzyme USP19 and its activation by HSP90 in the modulation of huntingtin aggregation. Xue, W., Zhang, S.X., He, W.T. et al. Biochem J (2020) 477:4295-4312. DOI 10.1042/BCJ20200536 · PubMed
Other PDB entries of the same protein (UniProt O94966 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.