1WHB: KIAA0055

Solution structure of the Rhodanese-like domain in human ubiquitin specific protease 8 (UBP8). Determined by solution NMR. Released 28 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,226
Mol. weight: 17.49 kDa
Released: 28 Nov 2004

Explore 1WHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WHB contains 9 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	16-17	2	1
α-helix	19-26	8
β-strand	33-38	6	1
α-helix	41-46	6
β-strand	49	1	2
β-strand	53-55	3	1
α-helix	66-71	6
α-helix	77-82	6
α-helix	83-85	3
β-strand	89-93	5	1
α-helix	99-101	3
α-helix	107-113	7
β-strand	129-131	3	1
α-helix	135-141	7
α-helix	143-145	3
β-strand	146	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIAA0055	A	protein	157	Homo sapiens	P40818 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WHB_1 KIAA0055 (chains A)
GSSGSSGKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAI
SPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWES
KTVLRNEPLVLEGGYENWLLCYPQYTTNAKVSGPSSG

Primary citation

Solution structure of the Rhodanese-like domain in human ubiquitin specific protease 8 (UBP8). Saito, K., Koshiba, S., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P40818 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
8ADM 1.7 Å, Ternary complex of 14-3-3 sigma, Usp8pS718 phosphopeptide and small molecule stabilizer
2GFO 2.0 Å, Structure of the Catalytic Domain of Human Ubiquitin Carboxyl-terminal Hydrolase 8
2A9U 2.1 Å, Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)
8XPN 2.1 Å, The Crystal Structure of USP8 from Biortus.
2GWF 2.3 Å, Structure of a USP8-NRDP1 complex
3N3K 2.6 Å, The catalytic domain of USP8 in complex with a USP8 specific inhibitor
8Y9A 3.1 Å, The Crystal Structure of USP8 from Biortus.

Browse structure collections

About this viewer

MolViewer shows 1WHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.