1WMH: Protein kinase C, iota type

Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha. Determined by X-ray diffraction at 1.5 Å resolution. Released 7 Dec 2004.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,511
Mol. weight: 19.88 kDa
Released: 7 Dec 2004

Explore 1WMH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WMH contains 6 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
β-strand	26-32	7	1
α-helix	38-48	11
β-strand	58-62	5	1
β-strand	68-70	3	1
α-helix	74-86	13
β-strand	92-97	6	1

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	1
β-strand	25-32	8	1
α-helix	33-35	3
α-helix	39-49	11
β-strand	58-62	5	1
β-strand	68-70	3	1
α-helix	74-80	7
α-helix	87	1
β-strand	88-93	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein kinase C, iota type	A	protein	89	Homo sapiens	P41743 (AlphaFold model)
Partitioning defective-6 homolog alpha	B	protein	86	Homo sapiens	Q9NPB6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WMH_1 Protein kinase C, iota type (chains A)
GPLGSQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCT
VSSQLELEEAFRLYELNKDSELLIHVFPC

Sequence of entity 2 (B), FASTA

>1WMH_2 Partitioning defective-6 homolog alpha (chains B)
GPHMSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLL
PLTNDDSLHRALASGPPPLRLLVQKR

Primary citation

Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains. Hirano, Y., Yoshinaga, S., Takeya, R. et al. J Biol Chem (2005) 280:9653-9661. DOI 10.1074/jbc.M409823200 · PubMed

Other PDB entries of the same protein (UniProt P41743 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LI9 1.79 Å, Structure of a nucleotide-bound form of PKCiota core kinase domain
3A8X 2.0 Å, Crystal Structure of PKCiota kinase domain
5LI1 2.0 Å, Structure of a Par3-inhibitory peptide bound to PKCiota core kinase domain
3A8W 2.1 Å, Crystal Structure of PKCiota kinase domain
8R3X 2.59 Å, Crystal structure of aPKC Iota kinase domain with LLGL2 peptide
3ZH8 2.74 Å, A novel small molecule aPKC inhibitor
1ZRZ 3.0 Å, Crystal Structure of the Catalytic Domain of Atypical Protein Kinase C-iota
9EJK 3.08 Å, Lgl2 bound to the aPKCiota-Par6b complex in nucleotide-free form. Head sub-complex…
5LIH 3.25 Å, Structure of a peptide-substrate bound to PKCiota core kinase domain
6ILZ 3.26 Å, Crystal structure of PKCiota in complex with inhibitor
9EJM 3.33 Å, Lgl2 bound to the aPKCiota-Par6B complex in its ADP-bound form
9EJL 3.48 Å, Lgl2 bound to the aPKCiota-Par6B complex in nucleotide-free form. Conformation with…

Browse structure collections

About this viewer

MolViewer shows 1WMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.