1WQ6: AML1-eto

The tetramer structure of the nervy homolgy two (NHR2) domain of AML1-ETO is critical for AML1-ETO'S activity. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Oct 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,099
Mol. weight: 18.31 kDa
Released: 4 Oct 2005

Explore 1WQ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WQ6 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-15	2
α-helix	16-68	53

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
α-helix	16-67	52

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AML1-eto	A, B	protein	72	Homo sapiens	Q06455 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1WQ6_1 AML1-ETO (chains A, B)
AMATRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNY
WIRRYSDAEDLK

Primary citation

The tetramer structure of the Nervy homology two domain, NHR2, is critical for AML1/ETO's activity. Liu, Y., Cheney, M.D., Gaudet, J.J. et al. Cancer Cell (2006) 9:249-260. DOI 10.1016/j.ccr.2006.03.012 · PubMed

Other PDB entries of the same protein (UniProt Q06455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JOL 2.91 Å, Complex structure of AML1-ETO NHR2 domain with HEB fragment
2DJ8 Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8)
2H7B Solution structure of the eTAFH domain from the human leukemia-associated fusion protein…
2KNH The Solution structure of the eTAFH domain of AML1-ETO complexed with HEB peptide
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
2OD1 Solution structure of the MYND domain from human AML1-ETO
2ODD Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor
2PP4 Solution Structure of ETO-TAFH refined in explicit solvent

Browse structure collections

About this viewer

MolViewer shows 1WQ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.