1WRL: N-terminal domain of human cardiac troponin C
Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine (monoclinic crystal form). Determined by X-ray diffraction at 2.6 Å resolution. Released 24 Jan 2006.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 4,301
- Mol. weight
- 64.84 kDa
- Ligands
- CA, TFP
- Released
- 24 Jan 2006
Explore 1WRL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1WRL contains 30 α-helices and 12 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-11 | 6 | |
| α-helix | 14-27 | 14 | |
| β-strand | 36 | 1 | 1 |
| α-helix | 38-47 | 10 | |
| α-helix | 54-62 | 9 | |
| β-strand | 72 | 1 | 1 |
| α-helix | 74-83 | 10 | |
Chain B: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-10 | 7 | |
| α-helix | 14-27 | 14 | |
| β-strand | 36 | 1 | 2 |
| α-helix | 38-47 | 10 | |
| α-helix | 54-62 | 9 | |
| β-strand | 72 | 1 | 2 |
| α-helix | 74-83 | 10 | |
Chain C: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-11 | 8 | |
| α-helix | 14-27 | 14 | |
| β-strand | 36 | 1 | 3 |
| α-helix | 38-47 | 10 | |
| α-helix | 54-64 | 11 | |
| β-strand | 72 | 1 | 3 |
| α-helix | 74-82 | 9 | |
Chain D: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 14-27 | 14 | |
| β-strand | 36 | 1 | 4 |
| α-helix | 38-47 | 10 | |
| α-helix | 54-63 | 10 | |
| β-strand | 72 | 1 | 4 |
| α-helix | 74-83 | 10 | |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-11 | 8 | |
| α-helix | 14-27 | 14 | |
| β-strand | 36 | 1 | 5 |
| α-helix | 38-47 | 10 | |
| α-helix | 54-62 | 9 | |
| β-strand | 72 | 1 | 5 |
| α-helix | 74-84 | 11 | |
Chain F: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| α-helix | 14-28 | 15 | |
| β-strand | 36 | 1 | 6 |
| α-helix | 38-46 | 9 | |
| α-helix | 54-62 | 9 | |
| β-strand | 72 | 1 | 6 |
| α-helix | 74-82 | 9 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Troponin C, slow skeletal and cardiac muscles | A, B, C, D, E, F | protein | 88 | Homo sapiens | P63316 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>1WRL_1 Troponin C, slow skeletal and cardiac muscles (chains A, B, C, D, E, F)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRSMKDD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 6 |
| TFP | 10-[3-(4-methyl-piperazin-1-yl)-propyl]-2-trifluoromethyl-10H-phenothiazine | C21 H24 F3 N3 S | 12 |
Primary citation
Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine. Takeda, S., Igarashi, T., Oishi, Y. et al. To be published.
Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3SD6 1.37 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
- 4GJE 1.6 Å, Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in…
- 3SWB 1.67 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
- 7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
- 4GJF 1.9 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q…
- 4GJG 2.0 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant…
- 4Y99 2.0 Å, Core domain of human cardiac troponin
- 1WRK 2.15 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
- 3RV5 2.2 Å, Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium…
- 7SC3 2.23 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
- 1J1D 2.61 Å, Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form
- 8FMO 2.61 Å, Complex structure of K210 deletion Troponin complex with risedronate
Browse structure collections
About this viewer
MolViewer shows 1WRL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.