Solution structure of the SH3 domain of the human cytoplasmic protein NCK2. Determined by solution NMR. Released 20 Jul 2005.
Explore 1WX6 in 3D Show helices and sheets RCSB PDB PDBe
1WX6 contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-22 | 5 | 1 |
| β-strand | 33 | 1 | 1 |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 54-58 | 5 | 1 |
| β-strand | 64-68 | 5 | 1 |
| α-helix | 69-71 | 3 | |
| β-strand | 72-77 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic protein NCK2 | A | protein | 91 | Homo sapiens | O43639 (AlphaFold model) |
>1WX6_1 Cytoplasmic protein NCK2 (chains A) GSSGSSGLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA RGQVGLVPKNYVVVLSDGPALHPAHSGPSSG
Solution structure of the SH3 domain of the human cytoplasmic protein NCK2. Ohnishi, S., Kigawa, T., Tomizawa, T. et al. To be published.
Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WX6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.