1WY8: Np95-like ring finger protein, isoform a

Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF). Determined by solution NMR. Released 9 Aug 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 704
Mol. weight: 10.04 kDa
Released: 9 Aug 2005

Explore 1WY8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WY8 contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	1
β-strand	20-26	7	1
β-strand	31	1	2
α-helix	32-42	11
β-strand	50-54	5	1
β-strand	57-58	2	1
β-strand	64	1	2
α-helix	65-68	4
α-helix	70-71	2
β-strand	75-80	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Np95-like ring finger protein, isoform a	A	protein	89	Homo sapiens	Q96PU4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WY8_1 Np95-like ring finger protein, isoform a (chains A)
GSSGSSGMWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLE
NGYTLFDYDVGLNDIIQLLVRPDSGPSSG

Primary citation

Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF). Zhao, C., Saito, K., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q96PU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PW7 2.0 Å, structure of UHRF2-SRA in complex with a 5mC-containing DNA
1Z6U 2.1 Å, Np95-like ring finger protein isoform b [Homo sapiens]
5YCO 2.2 Å, Complex structure of PCNA with UHRF2
4PW5 2.2 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I
4TVR 2.29 Å, Tandem Tudor and PHD domains of UHRF2
3OLN 2.3 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
4PW6 3.79 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex II
2E6S Solution structure of the PHD domain in RING finger protein 107

Browse structure collections

About this viewer

MolViewer shows 1WY8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.