structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex II. Determined by X-ray diffraction at 3.79 Å resolution. Released 7 May 2014.
Explore 4PW6 in 3D Show helices and sheets RCSB PDB PDBe
4PW6 contains 20 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 449-450 | 2 | |
| β-strand | 458-459 | 2 | 1 |
| α-helix | 462-468 | 7 | |
| β-strand | 478-481 | 4 | 1 |
| β-strand | 485-491 | 7 | 1 |
| β-strand | 500 | 1 | 1 |
| β-strand | 504-508 | 5 | 1 |
| α-helix | 533-539 | 7 | |
| β-strand | 551-552 | 2 | 1 |
| α-helix | 556-558 | 3 | |
| α-helix | 560-561 | 2 | |
| β-strand | 562-567 | 6 | 1 |
| α-helix | 568-572 | 5 | |
| β-strand | 582-597 | 16 | 1 |
| β-strand | 604-612 | 9 | 1 |
| α-helix | 617-618 | 2 | |
| α-helix | 622-630 | 9 | |
| α-helix | 635 | 1 | |
| β-strand | 636 | 1 | 1 |
| α-helix | 637-638 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase UHRF2 | A, B | protein | 230 | Homo sapiens | Q96PU4 (AlphaFold model) |
| 5hmC-containing DNA1 | C | DNA | 12 | ||
| 5hmC-containing DNA2 | D | DNA | 12 |
>4PW6_1 E3 ubiquitin-protein ligase UHRF2 (chains A, B) STESRRDWGRGMACVGRTRECTIVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGI HGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALA LNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEIS SSHGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGYPSDKEGK
>4PW6_2 5hmC-containing DNA1 (chains C) GTGATXGAAGTT
>4PW6_3 5hmC-containing DNA2 (chains D) AACTTCGATCAC
Structural Basis for Hydroxymethylcytosine Recognition by the SRA Domain of UHRF2. Zhou, T., Xiong, J., Wang, M. et al. Mol Cell (2014) 54:879-886. DOI 10.1016/j.molcel.2014.04.003 · PubMed
Other PDB entries of the same protein (UniProt Q96PU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.