4TVR: Tandem Tudor and PHD domains of UHRF2

Tandem Tudor and PHD domains of UHRF2. Determined by X-ray diffraction at 2.29 Å resolution. Released 24 Jun 2015.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,806
Mol. weight: 31.56 kDa
Ligands: ZN
Released: 24 Jun 2015

Explore 4TVR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TVR contains 10 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	120	1	1
β-strand	129	1	1
β-strand	132-137	6	2
β-strand	142-153	12	2
β-strand	207-213	7	2
α-helix	217-219	3
β-strand	222-224	3	2
α-helix	226-228	3
β-strand	229-231	3	2
α-helix	232-233	2
β-strand	236	1	3
α-helix	237-238	2
α-helix	239-241	3
β-strand	247-252	6	3
β-strand	262-273	12	3
β-strand	279-286	8	3
β-strand	293-298	6	3
α-helix	299	1
α-helix	305	1
β-strand	306	1	3
α-helix	307-309	3
α-helix	314-316	3
β-strand	347	1	4
β-strand	359-360	2	5
β-strand	368	1	4
β-strand	369-370	2	5
α-helix	377-378	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF2	A	protein	280	Homo sapiens	Q96PU4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4TVR_1 E3 ubiquitin-protein ligase UHRF2 (chains A)
GNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKN
GNIKHKSKENTNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART
ILKWNELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGGSEGTLN
DCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHE
PNMQLLCDECNVAYHIYCLNPPLDKVPAEEYWYCPSCKTD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Water and common crystallization additives (UNX) are not listed.

Primary citation

Structure of the Tandem Tudor and PHD domains of UHRF2. Walker, J.R., Dong, A., Zhang, Q. et al. To be published.

Other PDB entries of the same protein (UniProt Q96PU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PW7 2.0 Å, structure of UHRF2-SRA in complex with a 5mC-containing DNA
1Z6U 2.1 Å, Np95-like ring finger protein isoform b [Homo sapiens]
5YCO 2.2 Å, Complex structure of PCNA with UHRF2
4PW5 2.2 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I
3OLN 2.3 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
4PW6 3.79 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex II
1WY8 Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like…
2E6S Solution structure of the PHD domain in RING finger protein 107

Browse structure collections

About this viewer

MolViewer shows 4TVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.