2E6S: PHD domain in RING finger protein 107

Solution structure of the PHD domain in RING finger protein 107. Determined by solution NMR. Released 3 Jul 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 588
Mol. weight: 8.71 kDa
Ligands: ZN
Released: 3 Jul 2007

Explore 2E6S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E6S contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	41-43	3	1
α-helix	44	1
β-strand	50-52	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF2	A	protein	77	Homo sapiens	Q96PU4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2E6S_1 E3 ubiquitin-protein ligase UHRF2 (chains A)
GSSGSSGRNDTECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPL
DKVPEEEYWYCPSCKTD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Solution structure of the PHD domain in RING finger protein 107. Kadirvel, S., He, F., Muto, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q96PU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PW7 2.0 Å, structure of UHRF2-SRA in complex with a 5mC-containing DNA
1Z6U 2.1 Å, Np95-like ring finger protein isoform b [Homo sapiens]
5YCO 2.2 Å, Complex structure of PCNA with UHRF2
4PW5 2.2 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I
4TVR 2.29 Å, Tandem Tudor and PHD domains of UHRF2
3OLN 2.3 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
4PW6 3.79 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex II
1WY8 Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like…

Browse structure collections

About this viewer

MolViewer shows 2E6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.