Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2. Determined by solution NMR. Released 26 Oct 2005.
Explore 1X2Q in 3D Show helices and sheets RCSB PDB PDBe
1X2Q contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-22 | 5 | 1 |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 53-57 | 5 | 1 |
| β-strand | 60-64 | 5 | 1 |
| α-helix | 66-68 | 3 | |
| β-strand | 69-70 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Signal transducing adapter molecule 2 | A | protein | 88 | Homo sapiens | O75886 (AlphaFold model) |
>1X2Q_1 Signal transducing adapter molecule 2 (chains A) GSSGSSGSEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRG IGLFPSNFVTTNLNIETEAAAVSGPSSG
Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2. Chikayama, E., Kigawa, T., Sato, M. et al. To be published.
Other PDB entries of the same protein (UniProt O75886 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1X2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.