1X5B: Signal transducing adaptor molecule 2

The solution structure of the VHS domain of human Signal transducing adaptor molecule 2. Determined by solution NMR. Released 15 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,233
Mol. weight: 17.69 kDa
Released: 15 Nov 2005

Explore 1X5B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X5B contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	17-23	7
α-helix	33-45	13
α-helix	49-61	13
α-helix	66-82	17
α-helix	85-91	7
α-helix	94-105	12
α-helix	110-126	17
α-helix	134-144	11
α-helix	159-162	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
signal transducing adaptor molecule 2	A	protein	163	Homo sapiens	O75886 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X5B_1 signal transducing adaptor molecule 2 (chains A)
GSSGSSGMPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKR
VNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLM
VEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQTSGPSSG

Primary citation

The solution structure of the VHS domain of human Signal transducing adaptor molecule 2. Tochio, N., Koshiba, S., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt O75886 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CRV 2.0 Å, Crystal structure of the Bro domain of HD-PTP in a complex with the core region of STAM2
1X2Q Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2
2L0T Solution structure of the complex of ubiquitin and the VHS domain of Stam2
5IXF Solution structure of the STAM2 SH3 with AMSH derived peptide complex

Browse structure collections

About this viewer

MolViewer shows 1X5B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.