Crystal structure of the Bro domain of HD-PTP in a complex with the core region of STAM2. Determined by X-ray diffraction at 2.0 Å resolution. Released 24 Feb 2016.
Explore 5CRV in 3D Show helices and sheets RCSB PDB PDBe
5CRV contains 41 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| α-helix | 13-16 | 4 | |
| β-strand | 17 | 1 | 1 |
| α-helix | 23-30 | 8 | |
| α-helix | 42-56 | 15 | |
| α-helix | 62-81 | 20 | |
| β-strand | 94-97 | 4 | 1 |
| β-strand | 104-107 | 4 | 1 |
| α-helix | 110-129 | 20 | |
| α-helix | 137-160 | 24 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-195 | 25 | |
| α-helix | 200-221 | 22 | |
| α-helix | 224-230 | 7 | |
| α-helix | 232-262 | 31 | |
| α-helix | 266-286 | 21 | |
| α-helix | 292-315 | 24 | |
| α-helix | 316-320 | 5 | |
| α-helix | 327-329 | 3 | |
| α-helix | 331-335 | 5 | |
| α-helix | 349-352 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| α-helix | 13-15 | 3 | |
| β-strand | 16-17 | 2 | 2 |
| α-helix | 23-32 | 10 | |
| α-helix | 38-41 | 4 | |
| α-helix | 42-56 | 15 | |
| α-helix | 63-79 | 17 | |
| β-strand | 94-97 | 4 | 2 |
| β-strand | 104-107 | 4 | 2 |
| α-helix | 110-130 | 21 | |
| α-helix | 137-160 | 24 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-195 | 25 | |
| α-helix | 200-221 | 22 | |
| α-helix | 224-230 | 7 | |
| α-helix | 232-262 | 31 | |
| α-helix | 266-286 | 21 | |
| α-helix | 292-315 | 24 | |
| α-helix | 316-320 | 5 | |
| α-helix | 327-329 | 3 | |
| α-helix | 332-335 | 4 | |
| α-helix | 349-352 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 352-357 | 6 | |
| α-helix | 359-365 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 352-357 | 6 | |
| α-helix | 359-366 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein phosphatase non-receptor type 23 | A, B | protein | 361 | Homo sapiens | Q9H3S7 (AlphaFold model) |
| Signal transducing adapter molecule 2 | C, D | protein | 21 | Homo sapiens | O75886 (AlphaFold model) |
>5CRV_1 Tyrosine-protein phosphatase non-receptor type 23 (chains A, B) MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKAAGENPEAYNEELKKLELLRQNAVRVPR DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF TMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL V
>5CRV_2 Signal transducing adapter molecule 2 (chains C, D) LNVKVLEALELYNKLVNEAPV
Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0. Lee, J., Oh, K.-J., Lee, D. et al. PLoS One (2016) 11:e0149113-e0149113. DOI 10.1371/journal.pone.0149113 · PubMed
Other PDB entries of the same protein (UniProt Q9H3S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.