1X5P: RRM domain in Parp14

Solution structure of RRM domain in Parp14. Determined by solution NMR. Released 16 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 726
Mol. weight: 10.41 kDa
Released: 16 Nov 2005

Explore 1X5P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X5P contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	27-34	8
β-strand	40-46	7	1
β-strand	51-56	6	1
α-helix	59-68	10
β-strand	72-74	3	2
β-strand	77-79	3	2
β-strand	80-82	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Negative elongation factor E	A	protein	97	Homo sapiens	P18615 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X5P_1 Negative elongation factor E (chains A)
GSSGSSGERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKME
SADQAVAELNGTQVESVQLKVNIARKQPMLDSGPSSG

Primary citation

Solution structure of RRM domain in Parp14. Dang, W., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P18615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8JJ6 2.72 Å, Structure of the NELF-BCE complex
5OOB 2.79 Å, Complex of human nuclear cap-binding complex with M7GTP and nelf-E C-terminal peptide
8UHD 2.8 Å, Structure of paused transcription complex Pol II-DSIF-NELF - post-translocated
6GML 3.2 Å, Structure of paused transcription complex Pol II-DSIF-NELF
9J0O 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC1-nuc)
9J0P 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC2-nuc)
9J0N 3.4 Å, Paused elongation complex of mammalian RNA polymerase II with nucleosome (PEC2-nuc)
8UHA 3.5 Å, Structure of paused transcription complex Pol II-DSIF-NELF - tilted
8W8E 3.9 Å, human co-transcriptional RNA capping enzyme RNGTT
7YCX 4.18 Å, The structure of INTAC-PEC complex

Browse structure collections

About this viewer

MolViewer shows 1X5P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.