8JJ6: NELF-BCE complex
Structure of the NELF-BCE complex. Determined by X-ray diffraction at 2.72 Å resolution. Released 30 Aug 2023.
- Method
- X-ray diffraction
- Resolution
- 2.72 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 11,833
- Mol. weight
- 172.89 kDa
- Released
- 30 Aug 2023
Explore 8JJ6 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8JJ6 contains 107 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 41 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-7 | 4 | |
| α-helix | 13-20 | 8 | |
| α-helix | 26-36 | 11 | |
| α-helix | 42-53 | 12 | |
| α-helix | 58-81 | 24 | |
| α-helix | 86-100 | 15 | |
| α-helix | 101-103 | 3 | |
| α-helix | 110-118 | 9 | |
| α-helix | 125-133 | 9 | |
| α-helix | 135-139 | 5 | |
| α-helix | 143-150 | 8 | |
| α-helix | 154-176 | 23 | |
| α-helix | 192-195 | 4 | |
| α-helix | 199-208 | 10 | |
| α-helix | 212-229 | 18 | |
| α-helix | 233-247 | 15 | |
| α-helix | 251-254 | 4 | |
| α-helix | 260-272 | 13 | |
| α-helix | 277-288 | 12 | |
| α-helix | 297-306 | 10 | |
| α-helix | 308-327 | 20 | |
| α-helix | 332-334 | 3 | |
| α-helix | 336-356 | 21 | |
| α-helix | 362-365 | 4 | |
| α-helix | 367-368 | 2 | |
| α-helix | 369-373 | 5 | |
| α-helix | 374-391 | 18 | |
| α-helix | 402-404 | 3 | |
| α-helix | 409-417 | 9 | |
| α-helix | 419-434 | 16 | |
| α-helix | 438-444 | 7 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-468 | 10 | |
| α-helix | 469-476 | 8 | |
| α-helix | 479-485 | 7 | |
| α-helix | 486-490 | 5 | |
| α-helix | 491-493 | 3 | |
| α-helix | 498-511 | 14 | |
| α-helix | 517-526 | 10 | |
| α-helix | 535-550 | 16 | |
| α-helix | 551-553 | 3 | |
Chain B: 42 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-7 | 4 | |
| α-helix | 13-20 | 8 | |
| α-helix | 26-36 | 11 | |
| α-helix | 42-53 | 12 | |
| α-helix | 58-81 | 24 | |
| α-helix | 86-100 | 15 | |
| α-helix | 101-103 | 3 | |
| α-helix | 110-118 | 9 | |
| α-helix | 125-133 | 9 | |
| α-helix | 135-139 | 5 | |
| α-helix | 143-150 | 8 | |
| α-helix | 154-176 | 23 | |
| α-helix | 192-195 | 4 | |
| α-helix | 199-208 | 10 | |
| α-helix | 212-229 | 18 | |
| α-helix | 233-247 | 15 | |
| α-helix | 251-254 | 4 | |
| α-helix | 260-272 | 13 | |
| α-helix | 277-288 | 12 | |
| α-helix | 297-306 | 10 | |
| α-helix | 308-327 | 20 | |
| α-helix | 332-334 | 3 | |
| α-helix | 336-349 | 14 | |
| α-helix | 351-356 | 6 | |
| α-helix | 362-365 | 4 | |
| α-helix | 367-368 | 2 | |
| α-helix | 369-373 | 5 | |
| α-helix | 374-391 | 18 | |
| α-helix | 409-417 | 9 | |
| α-helix | 419-434 | 16 | |
| α-helix | 438-444 | 7 | |
| α-helix | 445-448 | 4 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-468 | 10 | |
| α-helix | 473-477 | 5 | |
| α-helix | 479-482 | 4 | |
| α-helix | 483-490 | 8 | |
| α-helix | 491-493 | 3 | |
| α-helix | 498-510 | 13 | |
| α-helix | 512-514 | 3 | |
| α-helix | 517-526 | 10 | |
| α-helix | 535-553 | 19 | |
Chain C: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-52 | 13 | |
| α-helix | 56-58 | 3 | |
| α-helix | 62-71 | 10 | |
| α-helix | 77-85 | 9 | |
| α-helix | 90-103 | 14 | |
| α-helix | 108-125 | 18 | |
| α-helix | 129-137 | 9 | |
| α-helix | 144-149 | 6 | |
| α-helix | 153-165 | 13 | |
| α-helix | 170-180 | 11 | |
Chain D: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-52 | 13 | |
| α-helix | 56-58 | 3 | |
| α-helix | 62-71 | 10 | |
| α-helix | 77-85 | 9 | |
| α-helix | 90-103 | 14 | |
| α-helix | 108-125 | 18 | |
| α-helix | 129-137 | 9 | |
| α-helix | 142-143 | 2 | |
| α-helix | 144-149 | 6 | |
| α-helix | 153-165 | 13 | |
| α-helix | 170-180 | 11 | |
Chain E: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-9 | 2 | |
| α-helix | 10-31 | 22 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-29 | 20 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Negative elongation factor B | A, B | protein | 560 | Homo sapiens | Q8WX92 (AlphaFold model) |
| Negative elongation factor complex member C/D | C, D | protein | 147 | Homo sapiens | Q8IXH7 (AlphaFold model) |
| Nelf-E | E, F | protein | 51 | Homo sapiens | P18615 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>8JJ6_1 Negative elongation factor B (chains A, B)
MFAGLQDLGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLE
FHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHL
PKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTE
LSVLHNFFSPSPKTRRQGEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAE
LLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGD
LSMILCDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQGAWDMIDSQVF
KEPKMEVELITRFLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPNTLPESFTKFLQEQRM
ACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAFGDIFLHLLTGNLALLADEFALED
FCSSLFDGFFLTASPRKENVHRHALRLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKEL
YSQLGEKLEQLDHRKPSPAQ
Sequence of entity 2 (C, D), FASTA
>8JJ6_2 Negative elongation factor complex member C/D (chains C, D)
EGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLSENYTAVAQTVN
LLAEWLIQTGVEPVQVQETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMIAHTTW
RDLFYKLAEAHPDCLMLNFTVKLISDA
Sequence of entity 3 (E, F), FASTA
>8JJ6_3 NELF-E (chains E, F)
MLVIPPGMSEEEEALQKKFMKLKKKKKALMALKKQSSSSTTSQGGVKRSLY
Primary citation
Structural basis of the human negative elongation factor NELF-B/C/E ternary complex. Cao, Y., Qin, Y., Zhang, W. et al. Biochem Biophys Res Commun (2023) 677:155-161. DOI 10.1016/j.bbrc.2023.08.019 · PubMed
Other PDB entries of the same protein (UniProt Q8WX92 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
- 8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
- 8UHD 2.8 Å, Structure of paused transcription complex Pol II-DSIF-NELF - post-translocated
- 6GML 3.2 Å, Structure of paused transcription complex Pol II-DSIF-NELF
- 9J0O 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC1-nuc)
- 9J0P 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC2-nuc)
- 9J0N 3.4 Å, Paused elongation complex of mammalian RNA polymerase II with nucleosome (PEC2-nuc)
- 8UHA 3.5 Å, Structure of paused transcription complex Pol II-DSIF-NELF - tilted
- 7PKS 3.6 Å, Structural basis of Integrator-mediated transcription regulation
- 8W8E 3.9 Å, human co-transcriptional RNA capping enzyme RNGTT
- 8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…
- 7YCX 4.18 Å, The structure of INTAC-PEC complex
Browse structure collections
About this viewer
MolViewer shows 8JJ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.