6GML: Paused transcription complex Pol II-DSIF-NELF

Name: PDB 6GML: Structure of paused transcription complex Pol II-DSIF-NELF
Published: 2018-09-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of paused transcription complex Pol II-DSIF-NELF. Determined by electron microscopy at 3.2 Å resolution. Released 5 Sept 2018.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Sus scrofa, Human immunodeficiency virus 1, Homo sapiens
Chains: 21
Atoms: 44,827
Mol. weight: 928.52 kDa
Ligands: ZN, MG
Released: 5 Sept 2018

Explore 6GML in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GML contains 274 α-helices and 279 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 73 helices, 65 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	1
β-strand	20-25	6	2
α-helix	26-27	2
α-helix	28-32	5
β-strand	86-88	3	3
β-strand	94-95	2	4
α-helix	100-109	10
α-helix	124-132	9
α-helix	137-147	11
β-strand	190-194	5	5
β-strand	197-201	5	5
β-strand	213-215	3	5
α-helix	216-217	2
α-helix	218-225	8
α-helix	230-235	6
α-helix	245-247	3
β-strand	249-250	2	4
β-strand	253-255	3	3
α-helix	256	1
α-helix	275-292	18
α-helix	293-297	5
α-helix	302-318	17
α-helix	326-328	3
β-strand	329	1	6
α-helix	334	1
β-strand	335	1	6
α-helix	336-337	2
α-helix	339-344	6
α-helix	350-355	6
β-strand	357-359	3	7
β-strand	362-369	8	8
β-strand	377-380	4	8
α-helix	382-385	4
β-strand	389-393	5	9
α-helix	399-408	10
β-strand	416-420	5	9
β-strand	426-428	3	9
α-helix	435-437	3
β-strand	445-449	5	9
α-helix	450	1
β-strand	455-459	5	8
α-helix	466-468	3
β-strand	469-476	8	8
β-strand	482-484	3	8
α-helix	489-492	4
β-strand	500-504	5	8
α-helix	509-518	10
β-strand	520	1	8
β-strand	526	1	10
β-strand	533	1	10
α-helix	539-548	10
β-strand	554-555	2	11
α-helix	557-563	7
α-helix	574	1
β-strand	575	1	12
α-helix	576-577	2
β-strand	579	1	13
β-strand	581	1	14
β-strand	585	1	13
β-strand	586-587	2	11
α-helix	588-595	8
β-strand	602-605	4	15
β-strand	627-631	5	15
β-strand	634-637	4	15
α-helix	642-645	4
α-helix	652-658	7
α-helix	663-683	21
β-strand	685-686	2	16
α-helix	690-692	3
α-helix	696-721	26
α-helix	733-756	24
α-helix	765-771	7
α-helix	778-781	4
α-helix	782-786	5
β-strand	789-790	2	17
β-strand	793	1	18
β-strand	796	1	18
α-helix	811	1
β-strand	822-823	2	17
α-helix	833-867	35
β-strand	872-873	2	19
β-strand	879-880	2	19
β-strand	886-888	3	19
α-helix	891-893	3
β-strand	896	1	20
β-strand	902-905	4	21
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	22
α-helix	936-944	9
α-helix	947-969	23
β-strand	976-979	4	21
α-helix	983-994	12
α-helix	1001	1
β-strand	1002	1	22
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1077	16
β-strand	1080	1	20
α-helix	1081-1082	2
α-helix	1087-1101	15
α-helix	1121-1128	8
β-strand	1139-1140	2	23
β-strand	1142	1	24
β-strand	1143	1	25
α-helix	1146-1149	4
α-helix	1151-1161	11
β-strand	1164	1	26
β-strand	1170-1177	8	27
α-helix	1190-1193	4
β-strand	1210-1216	7	27
α-helix	1218-1223	6
α-helix	1228-1239	12
α-helix	1240-1242	3
β-strand	1243-1246	4	27
β-strand	1255-1261	7	27
α-helix	1283-1293	11
β-strand	1299	1	26
β-strand	1308-1310	3	24
β-strand	1319-1322	4	28
β-strand	1328-1331	4	28
β-strand	1335-1337	3	24
β-strand	1352	1	25
β-strand	1358-1359	2	23
α-helix	1362-1368	7
α-helix	1372-1387	16
α-helix	1395-1404	10
α-helix	1416-1419	4
α-helix	1426-1430	5
α-helix	1436-1444	9
β-strand	1448-1449	2	2
α-helix	1455-1459	5
β-strand	1472-1475	4	29
α-helix	1484-1486	3

Chain B: 52 helices, 75 β-strands

Element	Residues	Length	Sheet
α-helix	22-36	15
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	65-67	3	30
β-strand	84-93	10	30
β-strand	97-98	2	31
β-strand	106-107	2	31
α-helix	110-115	6
β-strand	121-131	11	30
β-strand	141-153	13	30
β-strand	155	1	32
α-helix	168-173	6
β-strand	185-187	3	32
β-strand	190-194	5	32
β-strand	196-200	5	33
α-helix	201	1
β-strand	205-208	4	34
β-strand	215-223	9	34
β-strand	233-240	8	34
α-helix	241	1
β-strand	256-259	4	34
β-strand	263	1	35
β-strand	267-268	2	34
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-305	11
α-helix	314-322	9
β-strand	325	1	35
α-helix	336-345	10
α-helix	349-351	3
α-helix	358-377	20
α-helix	381-384	4
β-strand	391-394	4	33
α-helix	396-423	28
α-helix	431-434	4
α-helix	438-449	12
β-strand	467-469	3	32
α-helix	470	1
α-helix	475-481	7
β-strand	484-486	3	33
α-helix	503-505	3
β-strand	509	1	36
β-strand	523-525	3	33
β-strand	526	1	36
β-strand	531-532	2	37
α-helix	539-547	9
β-strand	550-552	3	38
α-helix	553-555	3
β-strand	565-569	5	38
β-strand	572-577	6	38
α-helix	584-591	8
β-strand	602-606	5	38
β-strand	611-615	5	38
β-strand	621-627	7	37
β-strand	628-629	2	39
β-strand	632-633	2	39
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	37
α-helix	667-670	4
β-strand	675-676	2	37
α-helix	679-682	4
β-strand	695-696	2	37
α-helix	700-703	4
α-helix	719-728	10
β-strand	732	1	40
β-strand	748-751	4	41
β-strand	755	1	42
β-strand	759-760	2	43
α-helix	763-765	3
β-strand	776-782	7	44
β-strand	783-784	2	16
β-strand	793-797	5	44
α-helix	798-802	5
β-strand	808-817	10	41
β-strand	827-829	3	45
β-strand	837-838	2	45
β-strand	848	1	46
β-strand	853	1	47
β-strand	854	1	46
α-helix	855	1
β-strand	859-860	2	41
β-strand	865-867	3	47
β-strand	869-871	3	45
β-strand	888-891	4	45
β-strand	894-895	2	47
α-helix	896-897	2
β-strand	902-911	10	41
β-strand	917-927	11	41
β-strand	934-936	3	44
β-strand	942-949	8	44
β-strand	956	1	48
α-helix	961-963	3
β-strand	965-967	3	44
α-helix	969-971	3
α-helix	978-993	16
β-strand	997-998	2	43
α-helix	1008-1016	9
β-strand	1025-1026	2	44
α-helix	1028	1
β-strand	1029	1	48
α-helix	1030	1
α-helix	1035	1
β-strand	1036	1	48
α-helix	1037	1
β-strand	1041-1050	10	44
β-strand	1051	1	40
α-helix	1055-1058	4
β-strand	1060	1	8
β-strand	1067	1	49
β-strand	1074	1	49
α-helix	1078-1080	3
α-helix	1082-1083	2
β-strand	1084-1086	3	7
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1115-1119	5	1
β-strand	1125	1	1
α-helix	1126	1
β-strand	1127-1129	3	50
β-strand	1134-1136	3	50
β-strand	1146-1150	5	1
α-helix	1153-1163	11
β-strand	1167-1172	6	2

Chain C: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	51
β-strand	18-24	7	51
α-helix	28-36	9
α-helix	37-41	5
β-strand	44-55	12	52
α-helix	61-69	9
β-strand	73	1	53
α-helix	82-84	3
α-helix	85-87	3
β-strand	99-106	8	52
α-helix	112	1
β-strand	113-115	3	54
α-helix	117-119	3
β-strand	121-122	2	52
β-strand	129	1	53
α-helix	145-148	4
β-strand	151-153	3	54
β-strand	158-168	11	52
α-helix	174-176	3
β-strand	179-185	7	51
α-helix	204-205	2
α-helix	218-220	3
β-strand	229-235	7	51
α-helix	241-270	30

Chain D: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	85
α-helix	17-19	3
β-strand	21	1	85
α-helix	29	1
β-strand	30-31	2	29
α-helix	34-49	16
α-helix	59-70	12
α-helix	77-88	12
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14

Chain E: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	4-24	21
β-strand	26	1	55
α-helix	30-33	4
α-helix	37-44	8
β-strand	63	1	56
β-strand	64	1	55
β-strand	71	1	56
β-strand	75	1	57
α-helix	84-96	13
β-strand	102-105	4	57
α-helix	109-111	3
α-helix	112-119	8
β-strand	127-130	4	57
α-helix	133-135	3
α-helix	139-141	3
β-strand	147-150	4	58
α-helix	151-152	2
α-helix	153-163	11
β-strand	172-173	2	59
α-helix	178-183	6
β-strand	191-197	7	58
β-strand	201-207	7	58
β-strand	208-209	2	59

Chain F: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	60
α-helix	59-74	16
α-helix	77-79	3
α-helix	89-98	10
β-strand	104-109	6	29
β-strand	115-119	5	29
β-strand	124	1	60
α-helix	125	1

Chain G: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	29
α-helix	15-17	3
α-helix	23-33	11
β-strand	38-39	2	29
β-strand	43-54	12	29
β-strand	58-59	2	29
α-helix	60	1
β-strand	66-77	12	29
β-strand	84-92	9	86
β-strand	96-101	6	86
β-strand	104-109	6	86
α-helix	110-112	3
β-strand	118-120	3	87
β-strand	127-129	3	87
β-strand	136-137	2	87
β-strand	142-152	11	86
β-strand	157-162	6	86
β-strand	169-170	2	86

Chain H: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-15	12	61
β-strand	25-32	8	61
β-strand	38-44	7	61
β-strand	55-61	7	61
β-strand	65	1	62
β-strand	74	1	12
β-strand	83	1	62
α-helix	84-86	3
β-strand	90	1	61
β-strand	91	1	14
β-strand	93-101	9	61
β-strand	111-118	8	61
β-strand	121-128	8	61
β-strand	139-142	4	61
β-strand	145-147	3	61

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit	A	protein	1970	Sus scrofa	A0A8D1DPV6
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa	I3LGP4 (AlphaFold model)
RNA polymerase II subunit C	C	protein	271	Sus scrofa	I3LCH3 (AlphaFold model)
RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7 (AlphaFold model)
RNA polymerase II subunit F	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
Uncharacterized protein	J	protein	67	Sus scrofa	A0A8W4F9W9
Uncharacterized protein	K	protein	117	Sus scrofa	F1RKE4
Uncharacterized protein	L	protein	58	Sus scrofa	A0A4X1TRS6
Non-template DNA	N	DNA	48	Human immunodeficiency virus 1
Tar RNA	P	RNA	46	Human immunodeficiency virus 1

9 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>6GML_1 DNA-directed RNA polymerase subunit (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>6GML_2 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>6GML_3 RNA polymerase II subunit C (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDV

Sequence of entity 4 (E), FASTA

>6GML_4 RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 5 (F), FASTA

>6GML_5 RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 6 (H), FASTA

>6GML_6 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 7 (I), FASTA

>6GML_7 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 8 (J), FASTA

>6GML_8 Uncharacterized protein (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 9 (K), FASTA

>6GML_9 Uncharacterized protein (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 10 (L), FASTA

>6GML_10 Uncharacterized protein (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Sequence of entity 11 (N), FASTA

>6GML_11 Non-template DNA (chains N)
GTACACTAGTACCTACTCGAGTGAGCTTAAGCCTCAATAAAGCTTGCC

Sequence of entity 12 (P), FASTA

>6GML_12 TAR RNA (chains P)
ACCAGAUCUGAGCCUGGGAGCUCUCUGGCUAACUAGGGAACCCACU

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	9
MG	Magnesium ion	Mg	1

Primary citation

Structure of paused transcription complex Pol II-DSIF-NELF. Vos, S.M., Farnung, L., Urlaub, H. et al. Nature (2018) 560:601-606. DOI 10.1038/s41586-018-0442-2 · PubMed

Other PDB entries of the same protein (UniProt A0A8D1DPV6), best resolution first:

9HVQ 2.0 Å, Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
8QEP 2.5 Å, RNA polymerase II bound to Alu RNA right arm
8B3D 2.6 Å, Structure of the Pol II-TCR-ELOF1 complex.
7OOB 2.7 Å, Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2)
8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
7F4G 2.78 Å, Structure of RPAP2-bound RNA polymerase II
8WAU 2.78 Å, De novo transcribing complex 11 (TC11), the early elongation complex with Pol II…

Browse structure collections

About this viewer

MolViewer shows 6GML directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.