Solution structures of the SH3 domain of human Src substrate cortactin. Determined by solution NMR. Released 17 Nov 2005.
Explore 1X69 in 3D Show helices and sheets RCSB PDB PDBe
1X69 contains 0 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-22 | 3 | 1 |
| β-strand | 33 | 1 | 2 |
| β-strand | 41-42 | 2 | 1 |
| β-strand | 43-47 | 5 | 2 |
| β-strand | 52-57 | 6 | 2 |
| β-strand | 60-65 | 6 | 2 |
| β-strand | 69-71 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cortactin isoform a | A | protein | 79 | Homo sapiens | Q14247 (AlphaFold model) |
>1X69_1 cortactin isoform a (chains A) GSSGSSGTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGR YGLFPANYVELRQSGPSSG
Solution structures of the SH3 domain of human Src substrate cortactin. Sato, M., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q14247 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1X69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.