1XPA: XPA

Solution structure of the DNA-and rpa-binding domain of the human repair factor xpa, NMR, 1 structure. Determined by solution NMR. Released 22 Jul 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 944
Mol. weight: 14.79 kDa
Ligands: ZN
Released: 22 Jul 1999

Explore 1XPA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XPA contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	103-104	2	1
β-strand	111-112	2	1
α-helix	117-120	4
β-strand	139-140	2	2
α-helix	141-147	7
β-strand	164-165	2	2
β-strand	180-181	2	2
α-helix	183-194	12
α-helix	197-209	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
XPA	A	protein	122	Homo sapiens	P23025 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XPA_1 XPA (chains A)
MEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEK
REPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQK
KF

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution structure of the DNA- and RPA-binding domain of the human repair factor XPA. Ikegami, T., Kuraoka, I., Saijo, M. et al. Nat Struct Biol (1998) 5:701-706. DOI 10.1038/1400 · PubMed

Other PDB entries of the same protein (UniProt P23025 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J44 2.06 Å, Crystal structure of the redefined DNA-binding domain of human XPA
6LAE 2.81 Å, Crystal structure of the DNA-binding domain of human XPA in complex with DNA
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
8EBU 3.3 Å, XPC release from Core7-XPA-DNA (Cy5)
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
6RO4 3.5 Å, Structure of the core TFIIH-XPA-DNA complex
7AD8 3.5 Å, Core TFIIH-XPA-DNA complex with modelled p62 subunit
9XYU 3.5 Å, NER complex - C7CAD.ATP
28KE 3.6 Å, Cryo-EM structure of the human holo-TFIIH-XPC-XPA complex bound to bulky lesion-mimic DNA
8EBX 3.6 Å, XPA repositioning Core7 of TFIIH relative to XPC-DNA lesion (AP)
8EBY 3.6 Å, XPC release from Core7-XPA-DNA (AP)

Browse structure collections

About this viewer

MolViewer shows 1XPA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.