Crystal Structure of Human Sulfiredoxin (Srx) in Complex with ADP. Determined by X-ray diffraction at 2.0 Å resolution. Released 24 May 2005.
Explore 1XW4 in 3D Show helices and sheets RCSB PDB PDBe
1XW4 contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-45 | 7 | 1 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-50 | 2 | 1 |
| α-helix | 59-71 | 13 | |
| α-helix | 73-75 | 3 | |
| α-helix | 77-78 | 2 | |
| β-strand | 79-85 | 7 | 1 |
| β-strand | 91-95 | 5 | 1 |
| α-helix | 99-107 | 9 | |
| β-strand | 112-120 | 9 | 1 |
| α-helix | 122-129 | 8 | |
| α-helix | 130-132 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sulfiredoxin | X | protein | 110 | Homo sapiens | Q9BYN0 (AlphaFold model) |
>1XW4_1 Sulfiredoxin (chains X) GPHMSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGA QGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Structural basis for the retroreduction of inactivated peroxiredoxins by human sulfiredoxin. Jonsson, T.J., Murray, M.S., Johnson, L.C. et al. Biochemistry (2005) 44:8634-8642. DOI 10.1021/bi050131i · PubMed
Other PDB entries of the same protein (UniProt Q9BYN0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.