Solution structure of human sulfiredoxin (srx). Determined by solution NMR. Released 22 Mar 2005.
Explore 1YZS in 3D Show helices and sheets RCSB PDB PDBe
1YZS contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-34 | 3 | |
| β-strand | 41-45 | 5 | 1 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-50 | 2 | 1 |
| α-helix | 59-71 | 13 | |
| α-helix | 73-75 | 3 | |
| β-strand | 79-85 | 7 | 1 |
| β-strand | 91-94 | 4 | 1 |
| α-helix | 99-107 | 9 | |
| β-strand | 112-119 | 8 | 1 |
| α-helix | 122-129 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| sulfiredoxin | A | protein | 121 | Homo sapiens | Q9BYN0 (AlphaFold model) |
>1YZS_1 sulfiredoxin (chains A) GAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSV PPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDL Q
Solution structure of human sulfiredoxin (srx). Gruschus, J.M., Lee, D.Y., Ferretti, J.A. et al. To be published.
Other PDB entries of the same protein (UniProt Q9BYN0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YZS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.