1XXF: FXIa Catalytic Domain

Crystal Structure of the FXIa Catalytic Domain in Complex with Ecotin Mutant (EcotinP). Determined by X-ray diffraction at 2.6 Å resolution. Released 16 Nov 2004.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 4
Atoms: 6,116
Mol. weight: 86.14 kDa
Released: 16 Nov 2004

Explore 1XXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XXF contains 33 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
β-strand	30-35	6	3
β-strand	37D-46	10	3
β-strand	51-54	4	3
α-helix	56-59	4
α-helix	62-64	3
β-strand	65-68	4	3
β-strand	73	1	4
α-helix	74-76	3
β-strand	83-90	8	3
β-strand	104-108	5	3
β-strand	115	1	5
β-strand	118	1	5
α-helix	121-122	2
β-strand	123	1	2
α-helix	124-125	2
α-helix	127-131	5
β-strand	136-140	5	2
β-strand	154	1	4
α-helix	155	1
β-strand	156-159	4	2
β-strand	162-163	2	6
α-helix	165-171	7
β-strand	180-183	4	6
β-strand	189	1	1
β-strand	198-202A	6	2
β-strand	202D-212	7	2
β-strand	213-217	5	6
β-strand	226-229	4	6
α-helix	231-234	4
α-helix	235-241	7

Chain B: 12 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	7
β-strand	20-21	2	8
β-strand	30-36	7	9
β-strand	37C-46	11	9
β-strand	51-54	4	9
α-helix	56-59	4
α-helix	62-64	3
β-strand	65-68	4	9
β-strand	73	1	10
α-helix	74-76	3
β-strand	83-90	8	9
α-helix	97-99	3
β-strand	104-108	5	9
α-helix	121-122	2
β-strand	123	1	8
α-helix	124-125	2
α-helix	127-129	3
β-strand	136-140	5	8
β-strand	154	1	10
α-helix	155	1
β-strand	156-159	4	8
β-strand	162-163	2	8
α-helix	165-170	6
β-strand	180-183	4	8
β-strand	189	1	7
β-strand	198-202	5	8
β-strand	203-216	10	8
β-strand	221	1	11
β-strand	224	1	11
α-helix	225	1
β-strand	226-230	5	8
α-helix	231-234	4
α-helix	235-242	8

Chain C: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	13-17	5
β-strand	20-25	6	6
α-helix	27-29	3
α-helix	33-35	3
β-strand	36-48	13	12
β-strand	53-54	2	6
β-strand	55	1	13
β-strand	56-63	8	6
β-strand	70-83	14	6
β-strand	93-98	6	12
β-strand	99	1	13
α-helix	102-105	4
β-strand	106-108	3	12
β-strand	115-120	6	6
β-strand	124-132	9	12
β-strand	137-138	2	12
β-strand	140-141	2	14

Chain D: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	13-16	4
β-strand	20-25	6	14
α-helix	27-29	3
α-helix	33-35	3
β-strand	36-48	13	12
β-strand	54	1	14
β-strand	55	1	15
β-strand	56-63	8	14
β-strand	70-81	12	14
β-strand	82-83	2	8
β-strand	93-98	6	12
β-strand	99	1	15
α-helix	102-105	4
β-strand	106-108	3	12
β-strand	115-120	6	14
β-strand	124-132	9	12
β-strand	137-138	2	12
α-helix	139	1
β-strand	140-141	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor XI	A, B	protein	238	Homo sapiens	P03951 (AlphaFold model)
Ecotin	C, D	protein	142	Escherichia coli	P23827 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1XXF_1 Coagulation factor XI (chains A, B)
IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG
ILNQAEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYADSQRPICLPSKGDR
NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGG
KDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV

Sequence of entity 2 (C, D), FASTA

>1XXF_2 Ecotin (chains C, D)
AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLE
NKTLEGWGYDYYVFDKVSSPDFTRVVCPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTP
DNVDVKYRVWKAEEKIDNAVVR

Primary citation

Crystal Structures of the FXIa Catalytic Domain in Complex with Ecotin Mutants Reveal Substrate-like Interactions. Jin, L., Pandey, P., Babine, R.E. et al. J Biol Chem (2005) 280:4704-4712. DOI 10.1074/jbc.M411309200 · PubMed

Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MBO 0.92 Å, FACTOR XIA (PICHIA PASTORIS; C500S [C122S]) IN COMPLEX WITH THE INHIBITOR Milvexian…
6TS4 1.17 Å, Coagulation factor XI protease domain in complex with active site inhibitor
4CRG 1.25 Å, Creating novel F1 inhibitors through fragment based lead generation and structure aided…
8BO6 1.25 Å, Coagulation factor XI protease domain in complex with active site inhibitor 2
8BO7 1.25 Å, Coagulation factor XI protease domain in complex with active site inhibitor 34
6USY 1.26 Å, Coagulation factor XI catalytic domain (C123S) in complex with nvp-XIV936
6TS5 1.29 Å, Coagulation factor XI protease domain in complex with active site inhibitor
6TS6 1.33 Å, Coagulation factor XI protease domain in complex with active site inhibitor
7V11 1.47 Å, Factor XIa in Complex with Compound 2e
5EXN 1.49 Å, FACTOR XIA (C500S [C122S]) IN COMPLEX WITH THE INHIBITOR methyl…
7V16 1.5 Å, Factor XIa in Complex with Compound 2j
7V17 1.52 Å, Factor XIa in Complex with Compound 2k

Browse structure collections

About this viewer

MolViewer shows 1XXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.