1Y9R: Mineralocorticoid receptor

Crystal structure of the human mineralocorticoid receptor ligand-binding domain bound to deoxycorticosterone and harboring the S810L mutation responsible for a severe form of hypertension. Determined by X-ray diffraction at 1.96 Å resolution. Released 24 May 2005.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,394
Mol. weight: 59.95 kDa
Ligands: 1CA
Released: 24 May 2005

Explore 1Y9R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y9R contains 22 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	738-745	8
α-helix	762-784	23
α-helix	790-792	3
α-helix	795-822	28
β-strand	827-830	4	1
β-strand	833-835	3	1
α-helix	841-843	3
α-helix	849-862	14
α-helix	866-877	12
β-strand	880-882	3	2
α-helix	889-907	19
α-helix	918-947	30
α-helix	949-952	4
α-helix	961-971	11
β-strand	976-978	3	2

Chain B: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	739-745	7
α-helix	762-783	22
α-helix	790-792	3
α-helix	795-822	28
β-strand	827-828	2	3
β-strand	834-835	2	3
α-helix	846-862	17
α-helix	866-877	12
β-strand	880-882	3	4
α-helix	889-906	18
α-helix	920-947	28
α-helix	949-952	4
α-helix	959-967	9
α-helix	968-970	3
β-strand	976-978	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mineralocorticoid receptor	A, B	protein	255	Homo sapiens	P08235 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Y9R_1 Mineralocorticoid receptor (chains A, B)
SSRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPG
FKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELC
QGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTK
APNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLP
KVESGNAKPLYFHRK

Ligands and cofactors

ID	Name	Formula	Copies
1CA	Desoxycorticosterone	C21 H30 O3	2

Primary citation

Crystal structure of a mutant mineralocorticoid receptor responsible for hypertension. Fagart, J., Huyet, J., Pinon, G.M. et al. Nat Struct Mol Biol (2005) 12:554-555. DOI 10.1038/nsmb939 · PubMed

Other PDB entries of the same protein (UniProt P08235 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PF3 1.1 Å, Mineralocorticoid receptor ligand-binding domain with compuond 37a
3VHV 1.35 Å, Mineralocorticoid receptor ligand-binding domain with non-steroidal antagonist
3WFG 1.4 Å, Mineralocorticoid receptor ligand-binding domain with compuond 2e
9GC7 1.46 Å, Mineralocorticoid receptor in complex with acylurea antagonists.
6GEV 1.54 Å, Mineralocorticoid receptor in complex with (s)-13
6GGG 1.71 Å, Mineralocorticoid receptor in complex with (s)-13
2AAX 1.75 Å, Mineralocorticoid Receptor Double Mutant with Bound Cortisone
5MWY 1.75 Å, The structure of MR in complex with eplerenone.
6GG8 1.8 Å, Mineralocorticoid receptor in complex with (s)-13
5MWP 1.82 Å, The structure of MR in complex with AZD9977.
5L7H 1.84 Å, MCR IN COMPLEX WITH ligand
2AB2 1.85 Å, Mineralocorticoid Receptor Double Mutant with Bound Spironolactone

Browse structure collections

About this viewer

MolViewer shows 1Y9R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.