1YN5: EapH2

Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens. Determined by X-ray diffraction at 2.2 Å resolution. Released 1 Mar 2005.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 1,667
Mol. weight: 23.33 kDa
Released: 1 Mar 2005

Explore 1YN5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YN5 contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	45-54	10	1
β-strand	57-58	2	1
β-strand	63-68	6	1
β-strand	72-74	3	2
α-helix	75-85	11
α-helix	86-90	5
α-helix	94-99	6
β-strand	102-109	8	1
β-strand	114-118	5	1
α-helix	119-121	3
β-strand	128-130	3	2
α-helix	131-133	3
β-strand	134-142	9	1

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	46-54	9	3
β-strand	57-58	2	3
β-strand	63-67	5	3
β-strand	72-74	3	4
α-helix	75-90	16
α-helix	94-99	6
β-strand	102-109	8	3
β-strand	114-118	5	3
β-strand	128-130	3	4
α-helix	131-133	3
β-strand	134-142	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EapH2	A, B	protein	103	Staphylococcus aureus	A0A0H3JUK5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1YN5_1 EapH2 (chains A, B)
AKEMQNVPYTIAVDGIMAFNQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAK
SAVYTITWKDGSKKEVDLKKDSYTANLFDSNSIKQIDINVKTK

Primary citation

The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens. Geisbrecht, B.V., Hamaoka, B.Y., Perman, B. et al. J Biol Chem (2005) 280:17243-17250. DOI 10.1074/jbc.M412311200 · PubMed

Other PDB entries of the same protein (UniProt A0A0H3JUK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8G25 1.8 Å, Crystal Structure of Cathepsin-G and Neutrophil Elastase Inhibited by S. aureus EapH2 at…
8G24 1.82 Å, Crystal Structure of Cathepsin-G and Neutrophil Elastase Inhibited by S. aureus EapH2 at…
8G26 1.85 Å, Crystal Structure of Cathepsin-G and Neutrophil Elastase Inhibited by S. aureus EapH2 at…
8GDG Solution structure of the Neutrophil Serine Protease Inhibitor, EapH2

Browse structure collections

About this viewer

MolViewer shows 1YN5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.