8GDG: Neutrophil Serine Protease Inhibitor, EapH2

Solution structure of the Neutrophil Serine Protease Inhibitor, EapH2. Determined by solution NMR. Released 26 Apr 2023.

Method: Solution NMR
Organism: Staphylococcus aureus
Chains: 1
Atoms: 921
Mol. weight: 13.12 kDa
Released: 26 Apr 2023

Explore 8GDG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GDG contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	1
β-strand	23-27	5	2
β-strand	30-31	2	2
β-strand	37-40	4	1
β-strand	45-46	2	3
α-helix	48-62	15
α-helix	69-72	4
β-strand	75-82	8	2
β-strand	87-91	5	2
α-helix	92-94	3
β-strand	102-103	2	3
α-helix	104-106	3
β-strand	107-115	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell surface like-protein Map-w	A	protein	117	Staphylococcus aureus	A0A0H3JUK5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8GDG_1 Cell surface like-protein Map-w (chains A)
GSTAEKDKLPATQKAKEMQNVPYTIAVDGIMAFNQSYLNLPKDSQLSYLDLGNKVKALLY
DERGVTPEKIRNAKSAVYTITWKDGSKKEVDLKKDSYTANLFDSNSIKQIDINVKTK

Primary citation

Simultaneous inhibition of two neutrophil serine proteases by the S. aureus innate immune evasion protein EapH2. Mishra, N., Herdendorf, T.J., Prakash, O. et al. J Biol Chem (2023) 299:104878-104878. DOI 10.1016/j.jbc.2023.104878 · PubMed

Other PDB entries of the same protein (UniProt A0A0H3JUK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8G25 1.8 Å, Crystal Structure of Cathepsin-G and Neutrophil Elastase Inhibited by S. aureus EapH2 at…
8G24 1.82 Å, Crystal Structure of Cathepsin-G and Neutrophil Elastase Inhibited by S. aureus EapH2 at…
8G26 1.85 Å, Crystal Structure of Cathepsin-G and Neutrophil Elastase Inhibited by S. aureus EapH2 at…
1YN5 2.2 Å, Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected…

Browse structure collections

About this viewer

MolViewer shows 8GDG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.