The crystal structure of the PSI/Hybrid domain/ I-EGF1 segment from the human integrin beta2 at 1.8 resolution. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Jul 2005.
Explore 1YUK in 3D Show helices and sheets RCSB PDB PDBe
1YUK contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-15 | 5 | |
| β-strand | 22-24 | 3 | 1 |
| α-helix | 36-39 | 4 | |
| β-strand | 40-41 | 2 | 1 |
| α-helix | 43-48 | 6 | |
| α-helix | 53-55 | 3 | |
| β-strand | 56-57 | 2 | 1 |
| β-strand | 62-66 | 5 | 2 |
| β-strand | 76-77 | 2 | 3 |
| β-strand | 80-85 | 6 | 2 |
| β-strand | 91-97 | 7 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 344-349 | 6 | 2 |
| β-strand | 356-363 | 8 | 3 |
| α-helix | 365-367 | 3 | |
| β-strand | 369-373 | 5 | 3 |
| β-strand | 376-379 | 4 | 2 |
| β-strand | 387-395 | 9 | 3 |
| α-helix | 399-401 | 3 | |
| β-strand | 402-408 | 7 | 2 |
| β-strand | 415-421 | 7 | 2 |
| α-helix | 436-439 | 4 | |
| β-strand | 441-444 | 4 | 4 |
| β-strand | 447-450 | 4 | 4 |
| α-helix | 451 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Integrin beta-2 A chain | A | protein | 103 | Homo sapiens | P05107 (AlphaFold model) |
| Integrin beta-2 B chain | B | protein | 120 | Homo sapiens | P05107 (AlphaFold model) |
>1YUK_1 Integrin beta-2 A chain (chains A) QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPT SLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGY
>1YUK_2 Integrin beta-2 B chain (chains B) SRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQ SFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NDG | 2-acetamido-2-deoxy-alpha-D-glucopyranose | C8 H15 N O6 | 2 |
The Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin {beta}2 Subunit at 1.8-A Resolution. Shi, M., Sundramurthy, K., Liu, B. et al. J Biol Chem (2005) 280:30586-30593. DOI 10.1074/jbc.M502525200 · PubMed
Other PDB entries of the same protein (UniProt P05107 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YUK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.