2JF1: Filamin a repeat 21

Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2 cytoplasmic tail peptide. Determined by X-ray diffraction at 2.2 Å resolution. Released 5 Feb 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 742
Mol. weight: 14.27 kDa
Released: 5 Feb 2008

Explore 2JF1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JF1 contains 3 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	1
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2255	1	2
β-strand	2257-2262	6	1
β-strand	2269-2277	9	2
β-strand	2281-2285	5	1
β-strand	2293-2299	7	1
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2319	1
β-strand	2321-2326	6	2

Chain T: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	754-762	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-a	A	protein	97	HOMO SAPIENS	P21333 (AlphaFold model)
Integrin beta-2 subunit	T	protein	35	HOMO SAPIENS	P05107 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JF1_1 FILAMIN-A (chains A)
GAMGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGS
CGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS

Sequence of entity 2 (T), FASTA

>2JF1_2 INTEGRIN BETA-2 SUBUNIT (chains T)
YRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Primary citation

Beta2 Integrin Phosphorylation on Thr758 Acts as a Molecular Switch to Regulate 14-3-3 and Filamin Binding. Takala, H., Nurminen, E., Nurmi, S.M. et al. Blood (2008) 112:1853. DOI 10.1182/BLOOD-2007-12-127795 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 2JF1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.