7USM: Integrin alphaM/beta2 ectodomain

Integrin alphaM/beta2 ectodomain. Determined by electron microscopy at 2.7 Å resolution. Released 17 Aug 2022.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 11,893
Mol. weight: 211.82 kDa
Ligands: CA, NAG
Released: 17 Aug 2022

Explore 7USM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7USM contains 53 α-helices and 135 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 82 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	9-12	4	2
β-strand	21-25	5	3
β-strand	29-33	5	3
β-strand	38-40	3	4
β-strand	43-44	2	4
β-strand	47-51	5	3
β-strand	56-59	4	3
β-strand	76-81	6	5
β-strand	84-96	13	5
β-strand	101-110	10	5
β-strand	340-343	4	6
β-strand	348-352	5	6
α-helix	355-358	4
β-strand	360	1	7
β-strand	361-365	5	6
β-strand	371-374	4	6
α-helix	376-378	3
β-strand	388	1	7
β-strand	391-397	7	8
β-strand	400-407	8	8
β-strand	414	1	9
β-strand	415-422	8	8
β-strand	425-433	9	8
β-strand	441	1	9
β-strand	445-448	4	10
β-strand	458-467	10	10
β-strand	471	1	11
β-strand	472-479	8	10
α-helix	480-481	2
α-helix	485-487	3
β-strand	491-494	4	10
β-strand	499	1	11
β-strand	508-510	3	12
β-strand	522-526	5	12
α-helix	529-532	4
β-strand	535-539	5	12
α-helix	540	1
β-strand	541-542	2	13
β-strand	546-547	2	13
β-strand	553-556	4	12
α-helix	557-560	4
β-strand	570-572	3	2
β-strand	584-589	6	2
β-strand	592-597	6	2
β-strand	598	1	1
α-helix	599-600	2
β-strand	601-610	10	14
β-strand	615	1	15
α-helix	617-620	4
β-strand	631-643	13	14
α-helix	649-650	2
β-strand	656-664	9	16
β-strand	674-675	2	14
β-strand	682-689	8	16
β-strand	694-702	9	14
β-strand	713-723	11	16
α-helix	724-725	2
β-strand	726	1	17
β-strand	732	1	17
β-strand	735-736	2	14
β-strand	743-748	6	16
α-helix	749	1
β-strand	750	1	15
α-helix	751-752	2
α-helix	758-760	3
β-strand	765-769	5	18
β-strand	776	1	19
β-strand	783-791	9	18
β-strand	797-798	2	20
β-strand	801-805	5	21
β-strand	806	1	22
β-strand	810-814	5	18
β-strand	830-832	3	21
β-strand	844	1	22
β-strand	847-849	3	21
β-strand	854-855	2	20
β-strand	860-869	10	18
β-strand	878-886	9	21
α-helix	895-897	3
β-strand	898-904	7	21
β-strand	905	1	19
β-strand	907-908	2	23
β-strand	911-914	4	24
β-strand	922-923	2	25
β-strand	932-943	12	24
β-strand	949-961	13	25
β-strand	964-965	2	25
β-strand	967	1	24
β-strand	971-974	4	24
β-strand	981-987	7	25
α-helix	994-1000	7
β-strand	1003-1004	2	25
β-strand	1010-1021	12	25
β-strand	1026-1036	11	24
β-strand	1048-1057	10	25
β-strand	1063-1064	2	23
α-helix	1065-1066	2
α-helix	1069-1072	4
β-strand	1074-1081	8	25

Chain B: 35 helices, 53 β-strands

Element	Residues	Length	Sheet
α-helix	11-16	6
β-strand	21-22	2	26
β-strand	23-24	2	27
α-helix	27-29	3
α-helix	36-39	4
β-strand	41-42	2	26
α-helix	43-49	7
β-strand	56-57	2	27
α-helix	59-61	3
β-strand	62-66	5	28
β-strand	76-77	2	29
β-strand	80-85	6	28
β-strand	87	1	29
β-strand	91-97	7	29
β-strand	99	1	30
β-strand	105-112	8	31
α-helix	115-117	3
α-helix	118-124	7
α-helix	128-136	9
β-strand	143-149	7	31
α-helix	162-166	5
α-helix	177-179	3
β-strand	182-189	8	31
α-helix	192-198	7
α-helix	199-201	3
β-strand	212	1	32
α-helix	214-223	10
α-helix	225-228	4
β-strand	234-241	8	31
β-strand	245	1	32
α-helix	250-254	5
α-helix	258-260	3
β-strand	267	1	31
β-strand	270	1	31
α-helix	279-281	3
α-helix	282-290	9
β-strand	294-300	7	31
α-helix	302-314	13
β-strand	319-322	4	31
α-helix	330-343	14
β-strand	347-349	3	28
α-helix	350-351	2
β-strand	356-363	8	29
β-strand	369-373	5	29
β-strand	376	1	28
β-strand	383	1	30
β-strand	387-395	9	29
α-helix	399-400	2
β-strand	402-408	7	28
β-strand	414-421	8	28
α-helix	429-431	3
α-helix	434-437	4
β-strand	442-444	3	33
β-strand	447-449	3	33
β-strand	454-455	2	34
β-strand	461-462	2	34
α-helix	466-468	3
α-helix	469-472	4
α-helix	481-482	2
α-helix	483-486	4
β-strand	488-491	4	35
β-strand	494-497	4	35
β-strand	507-508	2	36
β-strand	514-515	2	36
α-helix	520	1
β-strand	521-522	2	37
β-strand	525-526	2	37
β-strand	533-536	4	38
β-strand	539-542	4	38
α-helix	543	1
β-strand	546-547	2	39
β-strand	553-554	2	39
β-strand	561	1	40
β-strand	567	1	40
α-helix	568-570	3
β-strand	574-575	2	41
β-strand	578-579	2	41
α-helix	597-598	2
α-helix	599-602	4
α-helix	604-610	7
β-strand	617	1	42
β-strand	619	1	42
α-helix	621-624	4
β-strand	629-630	2	43
β-strand	638-643	6	43
β-strand	648-656	9	43
β-strand	663-667	5	43
β-strand	672-673	2	43

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-M	A	protein	1162	Homo sapiens	P11215 (AlphaFold model)
Integrin beta	B	protein	730	Homo sapiens	P05107 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7USM_1 Integrin alpha-M (chains A)
FNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPI
RLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQK
FPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEF
RIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVI
TDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVN
NFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAITSNGPLLSTVGSYDWAG
GVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLVLGAPRYQHIGLVAMFR
QNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQVSVCPL
PRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEDNRGAVYLFH
GTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQGHVLLLRSQP
VLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVTY
DLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFS
LVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDLSITFSFMSLDCLVVGG
PREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQRSWRLACESASSTEVS
GALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKANVTSENNMPRTNKTEFQ
LELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVR
LNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPF
FGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETK
VEPFEVPNGCGGLEVLFQGPGENAQCEKELQALEKENAQLEWELQALEKELAQWSHPQFE
KGGGSGGGGSGGSAWSHPQFEK

Sequence of entity 2 (B), FASTA

>7USM_2 Integrin beta (chains B)
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPT
SLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDD
LRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPF
AFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFA
TDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAV
TSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTY
DSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVL
PQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNN
SIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKC
RCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPC
GKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGM
DRYLIYVDESRECVAGPDGCGLEVLFQGPGKNAQCKKKLQALKKKNAQLKWKLQALKKKL
AQGGHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	9

Primary citation

Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin. Goldsmith, J.A., DiVenere, A.M., Maynard, J.A. et al. Cell Rep (2022) 40:111196-111196. DOI 10.1016/j.celrep.2022.111196 · PubMed

Other PDB entries of the same protein (UniProt P11215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MF7 1.25 Å, Integrin alpha M I domain
1NA5 1.5 Å, Integrin alpha M I domain
8CE6 1.58 Å, Crystal structure of human Cd11b I domain in P212121 space group
1IDO 1.7 Å, I-domain from integrin CR3, MG2+ bound
1JLM 2.0 Å, I-domain from integrin CR3, MN2+ bound
4XW2 2.0 Å, Structural basis for simvastatin competitive antagonism of complement receptor 3
8CE9 2.11 Å, Crystal structure of human Cd11b I domain in C121 space group
1M1U 2.3 Å, An isoleucine-based allosteric switch controls affinity and shape shifting in integrin…
1N9Z 2.5 Å, Integrin alpha M I domain mutant
9RM9 2.6 Å, Cryo-EM structure of alphaM/beta2 headpiece complex without alphaM I-domain - the…
1BHO 2.7 Å, Mac-1 I domain magnesium complex
1BHQ 2.7 Å, Mac-1 I domain cadmium complex

Browse structure collections

About this viewer

MolViewer shows 7USM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.