1Z2B: Tubulin alpha chain

Tubulin-colchicine-vinblastine: stathmin-like domain complex. Determined by X-ray diffraction at 4.1 Å resolution. Released 31 May 2005.

Method: X-ray diffraction
Resolution: 4.1 Å
Organisms: Bos taurus, Rattus norvegicus
Chains: 5
Atoms: 14,173
Mol. weight: 220.14 kDa
Ligands: MG, GTP, GDP, CN2
Released: 31 May 2005

Explore 1Z2B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z2B contains 91 α-helices and 66 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	10-28	19
β-strand	53	1	2
β-strand	63	1	2
β-strand	65-69	5	1
α-helix	74-78	5
α-helix	89-91	3
β-strand	92-94	3	1
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-125	15
β-strand	132-140	9	1
α-helix	144-160	17
β-strand	165-171	7	1
α-helix	183-195	13
β-strand	200-203	4	1
α-helix	206-215	10
α-helix	224-239	16
α-helix	241-245	5
α-helix	253-259	7
α-helix	268	1
β-strand	269-270	2	3
β-strand	277	1	4
α-helix	284-287	4
α-helix	288-295	8
α-helix	298-300	3
β-strand	312-314	3	5
β-strand	316-321	6	6
α-helix	325-337	13
β-strand	343	1	5
β-strand	352-356	5	6
β-strand	368	1	4
β-strand	373-374	2	6
β-strand	378-379	2	3
β-strand	380-381	2	5
α-helix	382-384	3
α-helix	385-399	15
α-helix	406-409	4
α-helix	415-433	19

Chain B: 21 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	7
α-helix	11-28	18
β-strand	30	1	8
β-strand	36	1	8
α-helix	44-49	4
β-strand	65-68	4	7
α-helix	74-79	6
α-helix	89-91	3
β-strand	92-93	2	7
α-helix	103-104	2
α-helix	105-109	5
α-helix	112-126	15
β-strand	134-140	7	7
α-helix	147-157	11
β-strand	165-172	8	7
α-helix	183-197	15
β-strand	200-205	6	7
α-helix	206-214	9
α-helix	225-239	15
α-helix	240-242	3
α-helix	253-259	7
β-strand	267-272	6	7
α-helix	289-295	7
α-helix	298-300	3
β-strand	301	1	7
β-strand	312-320	9	7
α-helix	326-338	13
α-helix	340-342	3
β-strand	343	1	7
β-strand	351-356	6	7
β-strand	375-381	7	7
α-helix	382-384	3
α-helix	385-396	12
α-helix	406-409	4
α-helix	416-432	17

Chain C: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	9
α-helix	10-28	19
β-strand	53	1	10
β-strand	63	1	10
β-strand	65-69	5	9
α-helix	75-78	4
α-helix	89-91	3
β-strand	92-94	3	9
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-127	17
β-strand	132-140	9	9
α-helix	144-160	17
β-strand	165-172	8	9
α-helix	183-195	13
β-strand	200-205	6	9
α-helix	206-215	10
α-helix	224-243	20
α-helix	254-259	6
α-helix	268	1
β-strand	269-270	2	11
β-strand	277	1	12
α-helix	288-295	8
α-helix	298-300	3
β-strand	312-314	3	13
β-strand	316-319	4	14
β-strand	320-321	2	15
α-helix	325-337	13
β-strand	343	1	13
β-strand	352-355	4	14
β-strand	368	1	12
β-strand	373-374	2	15
β-strand	378-379	2	11
β-strand	380-381	2	13
α-helix	382-384	3
α-helix	385-399	15
α-helix	406-409	4
α-helix	415-434	20

Chain D: 22 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	16
α-helix	11-27	17
β-strand	30	1	17
β-strand	36	1	17
α-helix	42-47	4
α-helix	49-51	3
β-strand	65-68	4	16
α-helix	74-79	6
α-helix	89-91	3
β-strand	92-93	2	16
α-helix	103-104	2
α-helix	105-109	5
α-helix	112-126	15
β-strand	134-140	7	16
α-helix	147-157	11
β-strand	165-172	8	16
α-helix	183-197	15
β-strand	200-205	6	16
α-helix	206-214	9
α-helix	225-239	15
α-helix	240-242	3
α-helix	253-259	7
β-strand	267-272	6	16
α-helix	289-295	7
α-helix	298-300	3
β-strand	301	1	16
β-strand	312-320	9	16
α-helix	325-338	14
α-helix	340-342	3
β-strand	343	1	16
β-strand	351-356	6	16
β-strand	375-381	7	16
α-helix	382-384	3
α-helix	385-398	14
α-helix	406-409	4
α-helix	416-432	17

Chain E: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	17-21	5	6
α-helix	61-67	7
α-helix	76-78	3
α-helix	79-85	7
α-helix	87-94	8
α-helix	99-102	4
α-helix	109-112	4
α-helix	116-120	5
α-helix	131-133	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha chain	A, C	protein	448	Bos taurus	Q2HJ86 (AlphaFold model)
Tubulin beta chain	B, D	protein	445	Bos taurus	Q6B856 (AlphaFold model)
RB3 stathmin-like domain 4	E	protein	142	Rattus norvegicus	P63043 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1Z2B_1 Tubulin alpha chain (chains A, C)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGIDSYEDEDEGEE

Sequence of entity 2 (B, D), FASTA

>1Z2B_2 Tubulin beta chain (chains B, D)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA

Sequence of entity 3 (E), FASTA

>1Z2B_3 RB3 STATHMIN-LIKE DOMAIN 4 (chains E)
ADMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKY
QEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERL
QEKDKHAEEVRKNKELKEEASR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
CN2	2-mercapto-N-[1,2,3,10-tetramethoxy-9-oxo-5,6,7,9-tetrahydro-benzo[a]heptalen-7…	C22 H25 N O6 S	2
VLB	(2ALPHA,2'BETA,3BETA,4ALPHA,5BETA)-vincaleukoblastine	C46 H58 N4 O9	1

Primary citation

Structural basis for the regulation of tubulin by vinblastine. Gigant, B., Wang, C., Ravelli, R.B. et al. Nature (2005) 435:519-522. DOI 10.1038/nature03566 · PubMed

Other PDB entries of the same protein (UniProt Q2HJ86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TVK 2.89 Å, The binding mode of epothilone A on a,b-tubulin by electron crystallography
7RRO 3.4 Å, Structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia
9CPB 3.52 Å, Atomic model of bovine Fallopian tube cilia doublet microtubule (48-nm periodicity)
1SA0 3.58 Å, Tubulin-colchicine: stathmin-like domain complex
1SA1 4.2 Å, Tubulin-podophyllotoxin: stathmin-like domain complex
2XRP 8.2 Å, Human Doublecortin N-DC Repeat (1MJD) and Mammalian Tubulin (1JFF and 3HKE) Docked into…
4ATX 8.2 Å, Rigor kinesin motor domain with an ordered neck-linker, docked on tubulin dimer,…
4ATU 8.3 Å, Human doublecortin N-DC repeat plus linker, and tubulin (2XRP) docked into an 8A cryo-EM…
3IZ0 8.6 Å, Human Ndc80 Bonsai Decorated Microtubule
4CK6 9.2 Å, Pseudo-atomic model of microtubule-bound human kinesin-5 motor domain in the ADP.AlFx…
4CK7 9.2 Å, Pseudo-atomic model of microtubule-bound human kinesin-5 motor domain in presence of…
5M5I 9.3 Å, Pseudo-atomic model of microtubule-bound S.pombe kinesin-5 motor domain in the AMPPNP…

Browse structure collections

About this viewer

MolViewer shows 1Z2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.