1Z2M: Interferon, alpha-inducible protein

Crystal Structure of ISG15, the Interferon-Induced Ubiquitin Cross Reactive Protein. Determined by X-ray diffraction at 2.5 Å resolution. Released 24 May 2005.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,213
Mol. weight: 17.22 kDa
Ligands: OS4
Released: 24 May 2005

Explore 1Z2M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z2M contains 6 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	14-18	5	1
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-48	6	1
β-strand	53	1	1
α-helix	61-63	3
β-strand	70-75	6	1
β-strand	82-87	6	2
β-strand	93-98	6	2
β-strand	103	1	3
α-helix	104-115	12
α-helix	119-121	3
β-strand	122-126	5	2
β-strand	129-130	2	2
β-strand	136	1	3
α-helix	137-140	4
β-strand	147-152	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
interferon, alpha-inducible protein (clone IFI-15K)	A	protein	155	Homo sapiens	P05161 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Z2M_1 interferon, alpha-inducible protein (clone IFI-15K) (chains A)
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKSDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLR

Ligands and cofactors

ID	Name	Formula	Copies
OS4	Osmium 4+ ion	Os	1

Primary citation

Crystal Structure of the Interferon-induced Ubiquitin-like Protein ISG15. Narasimhan, J., Wang, M., Fu, Z. et al. J Biol Chem (2005) 280:27356-27365. DOI 10.1074/jbc.M502814200 · PubMed

Other PDB entries of the same protein (UniProt P05161 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FFA 1.5 Å, FMDV Leader protease bound to substrate ISG15
3PHX 1.6 Å, OTU Domain of Crimean Congo Hemorrhagic Fever Virus in complex with ISG15
3RT3 2.01 Å, Complex of influenza virus protein with host anti-viral factor
7S6P 2.15 Å, The crystal structure of human ISG15
3SDL 2.29 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B…
6BI8 2.29 Å, X-ray structure of MERS coronavirus papain-like protease in complex with human ISG15
3PSE 2.3 Å, Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15)
3R66 2.3 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza…
5W8U 2.41 Å, Crystal structure of MERS-CoV papain-like protease in complex with the C-terminal domain…
9NN9 2.59 Å, ISG15 complexed with nanobody
5TL6 2.62 Å, Crystal structure of SARS-CoV papain-like protease in complex with the C-terminal domain…
9LW4 2.7 Å, UbCh8-ISG15 complex

Browse structure collections

About this viewer

MolViewer shows 1Z2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.