Structural Insight into the Binding Diversity between the Tyr-Phosphorylated Human EphrinBs and Nck2 SH2 Domain. Determined by solution NMR. Released 29 Mar 2005.
Explore 1Z3K in 3D Show helices and sheets RCSB PDB PDBe
1Z3K contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-17 | 6 | |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-43 | 7 | 1 |
| β-strand | 48-56 | 9 | 1 |
| β-strand | 59-62 | 4 | 1 |
| β-strand | 66-68 | 3 | 1 |
| α-helix | 73-76 | 4 | |
| β-strand | 84-85 | 2 | 2 |
| β-strand | 89-90 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic protein NCK2 | A | protein | 98 | Homo sapiens | O43639 (AlphaFold model) |
>1Z3K_1 Cytoplasmic protein NCK2 (chains A) REWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVY CIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ
Structural insight into the binding diversity between the Tyr-phosphorylated human ephrinBs and Nck2 SH2 domain. Ran, X., Song, J. J Biol Chem (2005) 280:19205-19212. DOI 10.1074/jbc.M500330200 · PubMed
Other PDB entries of the same protein (UniProt O43639 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1Z3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.