22VT: DNA replication licensing factor MCM2

Name: PDB 22VT: Structure of human MCM2-7 single hexamer with MCM3-WHD attached to MCM2-CTD, containing Meier-Gorlin Syndrome mutation (MCM3-Q761L)
Published: 2026-05-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: replication

Structure of human MCM2-7 single hexamer with MCM3-WHD attached to MCM2-CTD, containing Meier-Gorlin Syndrome mutation (MCM3-Q761L). Determined by electron microscopy at 3.3 Å resolution. Released 20 May 2026.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 6
Atoms: 27,147
Mol. weight: 549.35 kDa
Ligands: MG, ZN, ATP, ADP
Released: 20 May 2026

Explore 22VT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

22VT contains 180 α-helices and 176 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 2: 33 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	191-203	13
α-helix	214-224	11
β-strand	230-233	4	1
α-helix	234-238	5
α-helix	242-250	9
α-helix	252-270	19
β-strand	283-286	4	1
α-helix	294-296	3
α-helix	299-301	3
β-strand	305	1	2
β-strand	308-312	5	2
β-strand	314-315	2	3
β-strand	322-328	7	4
β-strand	335-340	6	4
α-helix	360-361	2
β-strand	362-370	9	4
β-strand	374-379	6	2
α-helix	390-392	3
β-strand	393-398	6	2
β-strand	411-414	4	2
β-strand	417-422	6	2
β-strand	435-440	6	2
β-strand	444-446	3	2
α-helix	459-469	11
α-helix	473-480	8
α-helix	489-500	12
β-strand	519-523	5	5
α-helix	529-539	11
β-strand	543	1	6
β-strand	546-547	2	5
β-strand	559-562	4	3
β-strand	569-572	4	3
α-helix	575-578	4
β-strand	582-583	2	6
β-strand	586-587	2	5
α-helix	594-605	12
β-strand	610-613	4	7
β-strand	616-619	4	7
β-strand	624-625	2	6
β-strand	627-629	3	5
α-helix	631-632	2
α-helix	633-635	3
α-helix	643-646	4
α-helix	651-656	6
β-strand	659-663	5	5
α-helix	669-685	17
α-helix	716-719	4
α-helix	720-726	7
α-helix	740-756	17
α-helix	760-761	2
α-helix	764-780	17
α-helix	788-802	15
α-helix	808-815	8
α-helix	819-822	4
α-helix	830-850	21
α-helix	852-854	3
α-helix	866-872	7
α-helix	878-882	5
α-helix	884-888	5
β-strand	892	1	8
β-strand	900	1	8

Chain 3: 30 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	16-19	4
α-helix	20-23	4
α-helix	39-42	4
β-strand	47-50	4	9
α-helix	51-57	7
α-helix	59-67	9
α-helix	70-87	18
α-helix	89-94	6
β-strand	100-103	4	9
α-helix	118-120	3
β-strand	121	1	10
β-strand	124-126	3	11
β-strand	129-135	7	12
α-helix	136-137	2
β-strand	197-202	6	12
α-helix	213-216	4
β-strand	217-221	5	12
β-strand	234-235	2	12
β-strand	238-240	3	11
β-strand	241	1	10
α-helix	255-257	3
β-strand	259-261	3	12
β-strand	264	1	11
α-helix	278-290	13
α-helix	296-301	6
α-helix	311-322	12
β-strand	327-328	2	13
β-strand	334-335	2	13
β-strand	341-345	5	14
α-helix	352-359	8
β-strand	366	1	14
β-strand	382-384	3	12
β-strand	391-394	4	12
α-helix	399-401	3
β-strand	404-409	6	14
α-helix	411-413	3
α-helix	416-427	12
β-strand	430-432	3	15
β-strand	441-443	3	15
β-strand	446-452	7	14
α-helix	465-468	4
α-helix	473-476	4
β-strand	481-485	5	14
α-helix	491-505	15
α-helix	507-509	3
α-helix	516-519	4
α-helix	565-576	12
β-strand	581	1	16
α-helix	584-598	15
α-helix	615-632	18
β-strand	636	1	16
α-helix	639-653	15
α-helix	741-758	18
β-strand	762-764	3	17
α-helix	765-774	10
α-helix	782-794	13
β-strand	798-801	4	17
β-strand	804-807	4	17

Chain 4: 27 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	159-171	13
α-helix	193-199	7
β-strand	207	1	18
α-helix	214-218	5
α-helix	220-228	9
α-helix	230-247	18
β-strand	259	1	18
α-helix	276-278	3
β-strand	282-285	4	19
β-strand	289-292	4	19
β-strand	299-300	2	20
β-strand	304-306	3	21
β-strand	312-313	2	21
β-strand	317-318	2	22
β-strand	321-322	2	22
β-strand	337-339	3	21
α-helix	341-343	3
β-strand	346-347	2	20
β-strand	349-354	6	19
β-strand	370-375	6	19
α-helix	376-378	3
β-strand	385	1	19
β-strand	388	1	23
β-strand	390-397	8	19
β-strand	400	1	24
β-strand	408-409	2	24
β-strand	411	1	25
β-strand	413-417	5	19
β-strand	423	1	23
α-helix	445-453	9
α-helix	458-464	7
α-helix	474-485	12
β-strand	506-509	4	26
β-strand	512	1	27
β-strand	514	1	27
α-helix	519-526	8
β-strand	533-534	2	26
β-strand	546-550	5	28
β-strand	555-559	5	28
α-helix	562-565	4
β-strand	570	1	29
β-strand	573-574	2	26
α-helix	581-592	12
β-strand	595-600	6	30
β-strand	603-608	6	30
β-strand	612	1	29
β-strand	614-617	4	26
α-helix	630-634	5
α-helix	638-641	4
β-strand	646-649	4	26
α-helix	656-670	15
α-helix	677-695	19
β-strand	701	1	31
α-helix	704-722	19
α-helix	732-747	16
β-strand	752	1	31
α-helix	755-772	18
β-strand	774	1	32
β-strand	781	1	32
α-helix	784-787	4
α-helix	792-794	3
α-helix	801-811	11
α-helix	821-830	10
α-helix	837-846	10
α-helix	847-849	3

Chain 5: 34 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	31-36	6
α-helix	47-52	6
α-helix	54-62	9
α-helix	74-78	5
α-helix	82-90	9
α-helix	92-107	16
α-helix	121-123	3
α-helix	133-136	4
α-helix	142-144	3
β-strand	153-157	5	50
β-strand	161	1	51
β-strand	225	1	51
β-strand	228-230	3	50
α-helix	241-243	3
β-strand	244-246	3	50
β-strand	248	1	52
β-strand	249	1	51
β-strand	262-263	2	50
β-strand	266-268	3	52
β-strand	295-298	4	52
α-helix	316	1
α-helix	317-321	5
α-helix	322-327	6
α-helix	330-334	5
α-helix	335-339	5
α-helix	347-358	12
β-strand	364	1	53
β-strand	370	1	53
β-strand	379	1	54
β-strand	380	1	55
α-helix	384-386	3
α-helix	387-391	5
α-helix	392-397	6
β-strand	401-403	3	56
β-strand	417-418	2	57
β-strand	428-430	3	57
α-helix	433-436	4
β-strand	441-443	3	56
β-strand	445	1	54
α-helix	447-449	3
α-helix	452-464	13
α-helix	508-513	6
β-strand	519	1	55
α-helix	556-568	13
β-strand	573	1	58
α-helix	576-578	3
α-helix	579-583	5
α-helix	584-589	6
α-helix	598-601	4
α-helix	610-626	17
β-strand	631	1	58
α-helix	634-648	15
α-helix	649-653	5
α-helix	665-682	18
β-strand	688-690	3	59
α-helix	691-700	10
α-helix	705-717	13
β-strand	721-724	4	59
β-strand	729-732	4	59

Chain 6: 30 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	22-35	14
α-helix	45-51	7
α-helix	52-54	3
β-strand	60-64	5	33
α-helix	65-71	7
α-helix	73-79	7
α-helix	87-99	13
α-helix	108-110	3
β-strand	111-115	5	33
α-helix	123-125	3
β-strand	131	1	34
β-strand	134-135	2	34
β-strand	138-144	7	34
β-strand	148-158	11	35
β-strand	164-169	6	35
α-helix	187-189	3
β-strand	191-193	3	35
β-strand	199-204	6	35
β-strand	206-209	4	34
β-strand	223-226	4	34
β-strand	228-229	2	35
α-helix	230-232	3
β-strand	241-251	11	34
β-strand	295-305	11	34
α-helix	322-328	7
α-helix	331-342	12
α-helix	346-354	9
α-helix	362-373	12
β-strand	378-379	2	36
β-strand	385-386	2	36
β-strand	392-396	5	37
α-helix	402-412	11
β-strand	417-420	4	37
β-strand	433-435	3	34
β-strand	442-444	3	34
β-strand	456-460	5	37
α-helix	462-464	3
α-helix	467-475	9
β-strand	481-486	6	38
β-strand	489-494	6	38
β-strand	498-503	6	37
α-helix	516-518	3
α-helix	524-529	6
β-strand	532-536	5	37
α-helix	543-557	15
α-helix	572-581	10
β-strand	585-586	2	39
α-helix	588-604	17
α-helix	610-611	2
β-strand	612	1	40
α-helix	619-634	16
β-strand	639-640	2	39
α-helix	642-655	14
α-helix	657	1
β-strand	658	1	40
α-helix	659	1
α-helix	722-738	17
α-helix	752-758	7
α-helix	768-776	9

Chain 7: 26 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	32-39	8
β-strand	47-49	3	41
α-helix	52-58	7
α-helix	60-68	9
α-helix	70-83	14
β-strand	135-137	3	41
β-strand	147	1	42
α-helix	149-151	3
β-strand	163	1	42
β-strand	165-170	6	43
β-strand	174-183	10	25
β-strand	190-194	5	25
β-strand	199-200	2	24
α-helix	201-203	3
β-strand	205	1	44
α-helix	209-214	6
β-strand	219	1	44
β-strand	221-232	12	25
β-strand	234-238	5	43
α-helix	249-251	3
β-strand	252-256	5	43
β-strand	270-271	2	43
β-strand	298-299	2	43
α-helix	333-339	7
α-helix	348-359	12
β-strand	377-378	2	45
β-strand	381	1	46
α-helix	387-397	11
β-strand	401-404	4	45
α-helix	407-409	3
α-helix	410-414	5
β-strand	416	1	47
α-helix	425-427	3
β-strand	431	1	47
β-strand	441-444	4	45
α-helix	452-464	13
β-strand	466	1	48
β-strand	479	1	48
β-strand	483-486	4	45
α-helix	501-504	4
α-helix	509-514	6
β-strand	517-518	2	45
β-strand	521	1	46
α-helix	527-543	17
α-helix	546-548	3
α-helix	556-565	10
β-strand	572	1	49
α-helix	573-574	2
α-helix	575-577	3
α-helix	578-595	18
α-helix	603-619	17
β-strand	624	1	49
α-helix	627-640	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA replication licensing factor MCM2	2	protein	904	Homo sapiens	P49736 (AlphaFold model)
DNA replication licensing factor MCM3	3	protein	808	Homo sapiens	P25205 (AlphaFold model)
DNA replication licensing factor MCM4	4	protein	863	Homo sapiens	P33991 (AlphaFold model)
DNA replication licensing factor MCM6	6	protein	821	Homo sapiens	Q14566 (AlphaFold model)
DNA replication licensing factor MCM7	7	protein	719	Homo sapiens	P33993
DNA replication licensing factor MCM5	5	protein	734	Homo sapiens	P33992

Sequence of entity 1 (2), FASTA

>22VT_1 DNA replication licensing factor MCM2 (chains 2)
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF

Sequence of entity 2 (3), FASTA

>22VT_2 DNA replication licensing factor MCM3 (chains 3)
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGT
YRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
KSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQ
DTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQV
HTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHALSIGMNRLTESINRDSEEPF
SSVEIQAALSKMQDDNQVMVSEGIIFLI

Sequence of entity 3 (4), FASTA

>22VT_3 DNA replication licensing factor MCM4 (chains 4)
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL

Sequence of entity 4 (6), FASTA

>22VT_4 DNA replication licensing factor MCM6 (chains 6)
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Sequence of entity 5 (7), FASTA

>22VT_5 DNA replication licensing factor MCM7 (chains 7)
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Sequence of entity 6 (5), FASTA

>22VT_6 DNA replication licensing factor MCM5 (chains 5)
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3
ZN	Zinc ion	Zn	4
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	3
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Structure of human MCM2-7 single hexamer with MCM3-WHD containing Meier-Gorlin Syndrome mutation (Q761L) attached to MCM2-CTD. Lam, W.H., Fan, X., Zhai, Y. To be published.

Other PDB entries of the same protein (UniProt P49736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YA7 1.67 Å, Cdc7-Dbf4 bound to an Mcm2-S40 derived bivalent substrate
7CIZ 1.8 Å, Crystal structure of DNAJC9 HBD helix2 in complex with H3.3-H4 dimer and MCM2 HBD
5BNX 2.31 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.3-H4 dimer
5JA4 2.42 Å, Crystal structure of human TONSL and MCM2 HBDs binding to a histone H3-H4 tetramer
7CJ0 2.5 Å, Crystal structure of DNAJC9 HBD in complex with H3.3-H4 dimer and MCM2 HBD
7W1Y 2.59 Å, Human MCM double hexamer bound to natural DNA duplex (polyAT/polyTA)
9E2Z 2.6 Å, Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template
5BNV 2.79 Å, Crystal structure of Human MCM2 HBD chaperoning a histone H3-H4 tetramer
7PLO 2.8 Å, H. sapiens replisome-CUL2/LRR1 complex
8W0F 2.8 Å, Cryo-EM structure of a human MCM2-7 double hexamer on dsDNA
4UUZ 2.9 Å, MCM2-histone complex
5BO0 2.91 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.2-H4 dimer

Browse structure collections

About this viewer

MolViewer shows 22VT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.