7CJ0: DNAJC9 HBD
Crystal structure of DNAJC9 HBD in complex with H3.3-H4 dimer and MCM2 HBD. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Apr 2021.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 4,696
- Mol. weight
- 75.3 kDa
- Released
- 14 Apr 2021
Explore 7CJ0 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7CJ0 contains 25 α-helices and 13 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 173-204 | 32 | |
| α-helix | 213-242 | 30 | |
Chain B: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 64-76 | 13 | |
| β-strand | 83 | 1 | 3 |
| β-strand | 84-85 | 2 | 4 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 5 |
| α-helix | 121-131 | 11 | |
Chain C: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 5 |
| α-helix | 50-75 | 26 | |
| β-strand | 80 | 1 | 3 |
| α-helix | 83-96 | 14 | |
Chain D: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 175-207 | 33 | |
| α-helix | 209-210 | 2 | |
| α-helix | 213-242 | 30 | |
| α-helix | 244-247 | 4 | |
Chain E: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 64-75 | 12 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-131 | 11 | |
Chain F: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-96 | 14 | |
Chain G: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 70-71 | 2 | 2 |
| α-helix | 77-81 | 5 | |
| β-strand | 95 | 1 | 1 |
| α-helix | 103-106 | 4 | |
| α-helix | 107-122 | 16 | |
Chain H: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 70-71 | 2 | 5 |
| β-strand | 95-96 | 2 | 4 |
| α-helix | 103-106 | 4 | |
| α-helix | 107-124 | 18 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3.3 | B, E | protein | 79 | Homo sapiens | P84243 (AlphaFold model) |
| Histone H4 | C, F | protein | 102 | Homo sapiens | P62805 (AlphaFold model) |
| DNA replication licensing factor MCM2 | G, H | protein | 70 | Homo sapiens | P49736 (AlphaFold model) |
| DnaJ homolog subfamily C member 9 | A, D | protein | 84 | Homo sapiens | Q8WXX5 (AlphaFold model) |
Sequence of entity 1 (B, E), FASTA
>7CJ0_1 Histone H3.3 (chains B, E)
STELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR
VTIMPKDIQLARRIRGERA
Sequence of entity 2 (C, F), FASTA
>7CJ0_2 Histone H4 (chains C, F)
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 3 (G, H), FASTA
>7CJ0_3 DNA replication licensing factor MCM2 (chains G, H)
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGR
Sequence of entity 4 (A, D), FASTA
>7CJ0_4 DnaJ homolog subfamily C member 9 (chains A, D)
GPLGSEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQK
DRQKEMDNFLAQMEAKYSKSSKGG
Primary citation
DNAJC9 integrates heat shock molecular chaperones into the histone chaperone network. Hammond, C.M., Bao, H., Hendriks, I.A. et al. Mol Cell (2021) 81:2533-2548.e9. DOI 10.1016/j.molcel.2021.03.041 · PubMed
Other PDB entries of the same protein (UniProt P84243 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3QL9 0.93 Å, Monoclinic complex structure of ATRX ADD bound to histone H3K9me3 peptide
- 4GNE 1.47 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-7
- 4L58 1.48 Å, Crystal structure of the MLL5 PHD finger in complex with H3K4me3
- 5JLB 1.5 Å, Crystal structure of SETD2 bound to histone H3.3 K36I peptide
- 4GNF 1.55 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-15
- 3QLA 1.6 Å, Hexagonal complex structure of ATRX ADD bound to H3K9me3 peptide
- 3MUL 1.65 Å, Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14
- 9G4A 1.65 Å, Structure of human SETD2 T1663M mutant in complex with SAM and H3K36M peptide
- 4GNG 1.73 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3K9me3 peptide
- 3MUK 1.75 Å, Crystal structure of Brd4 bromodomain 1 with propionylated histone H3-K(prop)23
- 4QQ4 1.75 Å, CW-type zinc finger of MORC3 in complex with the amino terminus of histone H3
- 1PDQ 1.76 Å, Polycomb chromodomain complexed with the histone H3 tail containing trimethyllysine 27.
Browse structure collections
About this viewer
MolViewer shows 7CJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.