KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor example-41. Determined by X-ray diffraction at 1.3 Å resolution. Released 9 Sept 2026.
Explore 29UU in 3D Show helices and sheets RCSB PDB PDBe
29UU contains 12 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 511-514 | 4 | 1 |
| β-strand | 517-520 | 4 | 1 |
| α-helix | 529-532 | 4 | |
| β-strand | 537-539 | 3 | 1 |
| β-strand | 546-547 | 2 | 1 |
| α-helix | 550-559 | 10 | |
| β-strand | 568-573 | 6 | 2 |
| β-strand | 576-582 | 7 | 2 |
| α-helix | 587-598 | 12 | |
| β-strand | 613-622 | 10 | 2 |
| β-strand | 625-635 | 11 | 2 |
| β-strand | 642-644 | 3 | 3 |
| β-strand | 647-649 | 3 | 2 |
| α-helix | 651-653 | 3 | |
| α-helix | 658-672 | 15 | |
| β-strand | 677 | 1 | 4 |
| β-strand | 678-679 | 2 | 3 |
| α-helix | 680 | 1 | |
| α-helix | 682-684 | 3 | |
| α-helix | 685-705 | 21 | |
| α-helix | 712-719 | 8 | |
| β-strand | 721 | 1 | 4 |
| α-helix | 723-732 | 10 | |
| β-strand | 736-739 | 4 | 5 |
| β-strand | 742-745 | 4 | 5 |
| α-helix | 749-757 | 9 | |
| α-helix | 770-772 | 3 | |
| β-strand | 773 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone acetyltransferase KAT8 | AAA | protein | 278 | Homo sapiens | Q9H7Z6 (AlphaFold model) |
>29UU_1 Histone acetyltransferase KAT8 (chains AAA) GSTKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQ WRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEV DRQGAHIVGYFSKEKESPDGNNVSCIMILPPYQRRGYGRFLIAFSYELSKLESTVGSPEK PLSDLGKLSYRSYWSSVLLENLRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKG QHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| A1J4U | 7-iodanyl-N-[(2R)-2-(1,3-oxazol-2-yl)-2-phenyl-ethyl]-1,1-bis(oxidanylidene)-2H… | C19 H15 I N4 O4 S | 1 |
Water and common crystallization additives (GOL, CL, PEG) are not listed.
KAT6A-inhibitor co-crystal structures: tackling a challenging crystallization target via two alternative approaches. Puetter, V., Bouche, L., Nowak-Reppel, K. et al. Acta Crystallogr D Struct Biol (2026). DOI 10.1107/S2059798326008545 · PubMed
Other PDB entries of the same protein (UniProt Q9H7Z6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 29UU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.