2PQ8: MYST histone acetyltransferase 1

Name: PDB 2PQ8: MYST histone acetyltransferase 1
Published: 2007-05-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

MYST histone acetyltransferase 1. Determined by X-ray diffraction at 1.45 Å resolution. Released 15 May 2007.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,334
Mol. weight: 33.39 kDa
Ligands: ZN, COA
Released: 15 May 2007

Explore 2PQ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PQ8 contains 14 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	181-184	4	1
β-strand	187-190	4	1
α-helix	199-203	5
β-strand	207-209	3	1
β-strand	216-217	2	1
α-helix	220-229	10
β-strand	238-243	6	2
β-strand	246-252	7	2
α-helix	257-268	12
α-helix	274-277	4
β-strand	283-292	10	2
β-strand	295-305	11	2
β-strand	312-314	3	3
β-strand	317-319	3	2
α-helix	321-323	3
α-helix	328-342	15
β-strand	347	1	4
β-strand	348-349	2	3
α-helix	350	1
α-helix	353-354	2
α-helix	355-372	18
α-helix	383-389	7
β-strand	391	1	4
α-helix	393-402	10
β-strand	406-407	2	5
β-strand	414-415	2	5
α-helix	419-427	9
α-helix	432-434	3
α-helix	440-442	3
β-strand	443	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable histone acetyltransferase MYST1	A	protein	278	Homo sapiens	Q9H7Z6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PQ8_1 Probable histone acetyltransferase MYST1 (chains A)
GSTKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQ
WRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHRTLYFDVEPFVFYILTEV
DRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEK
PLSDLGKLSYRSYWSWVLLENLRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKG
QHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
COA	Coenzyme a	C21 H36 N7 O16 P3 S	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

MYST histone acetyltransferase 1. Wu, H., Tempel, W., Dombrovski, L. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H7Z6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

29UU 1.3 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor example-41
9OOA 1.39 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 7
29UT 1.4 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor compound 2
9OOF 1.68 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 10e
29TM 1.7 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor bay-7728
6OIN 1.7 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor CTX-124143
6OIO 1.7 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 60
6OIQ 1.75 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 63
6OWI 1.75 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 85
5WCI 1.78 Å, Human MYST histone acetyltransferase 1
29TN 1.8 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor compound 38
6OIP 1.8 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 34

Browse structure collections

About this viewer

MolViewer shows 2PQ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.