2A2N: Peptidylprolyl isomerase domain of Human PPWD1

Name: PDB 2A2N: Crystal Structure of the peptidylprolyl isomerase domain of Human PPWD1
Published: 2005-07-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Crystal Structure of the peptidylprolyl isomerase domain of Human PPWD1. Determined by X-ray diffraction at 1.65 Å resolution. Released 5 Jul 2005.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,259
Mol. weight: 58.59 kDa
Released: 5 Jul 2005

Explore 2A2N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A2N contains 9 α-helices and 44 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	493-498	6	1
β-strand	501-507	7	1
α-helix	513-524	12
β-strand	532	1	2
β-strand	535-537	3	1
β-strand	541-544	4	1
β-strand	562	1	3
β-strand	577-580	4	1
β-strand	588	1	3
β-strand	592-595	4	1
α-helix	600-602	3
β-strand	608-614	7	1
α-helix	616-623	8
β-strand	627	1	4
β-strand	634	1	4
β-strand	639	1	2
β-strand	640-645	6	1

Chain B: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	493-498	6	5
β-strand	501-507	7	5
α-helix	513-524	12
β-strand	532	1	6
β-strand	535-537	3	5
β-strand	541-544	4	5
β-strand	562	1	7
β-strand	577-580	4	5
β-strand	588	1	7
β-strand	592-595	4	5
α-helix	600-602	3
β-strand	608-614	7	5
α-helix	616-623	8
β-strand	627-628	2	8
β-strand	633-634	2	8
β-strand	639	1	6
β-strand	640-645	6	5

Chain C: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	493-498	6	9
β-strand	501-507	7	9
α-helix	513-525	13
β-strand	532	1	10
β-strand	535-537	3	9
β-strand	541-544	4	9
β-strand	562	1	11
β-strand	567	1	12
β-strand	570	1	12
β-strand	577-580	4	9
β-strand	588	1	11
β-strand	592-595	4	9
α-helix	600-602	3
β-strand	608-614	7	9
α-helix	616-623	8
β-strand	627-628	2	13
β-strand	633-634	2	13
β-strand	639	1	10
β-strand	640-645	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
peptidylprolyl isomerase domain and WD repeat containing 1	A, B, C	protein	176	Homo sapiens	Q96BP3 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2A2N_1 peptidylprolyl isomerase domain and WD repeat containing 1 (chains A, B, C)
GSPSKEEVMAATQAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNG
HTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGS
QFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK

Primary citation

The crystal structure of human WD40 repeat-containing peptidylprolyl isomerase (PPWD1). Davis, T.L., Walker, J.R., Ouyang, H. et al. FEBS J (2008) 275:2283-2295. DOI 10.1111/j.1742-4658.2008.06381.x · PubMed

Other PDB entries of the same protein (UniProt Q96BP3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XTT 2.92 Å, Human minor spliceosome branching-completed C complex (after step-I)
9XU3 3.0 Å, Human minor spliceosome exon-ligation-ready C* complex (prior to step-II)
9FMD 3.3 Å, Integrative model of the human post-catalytic spliceosome (P-complex)
8I0W 3.4 Å, The cryo-EM structure of human C complex
5YZG 4.1 Å, The Cryo-EM Structure of Human Catalytic Step I Spliceosome (C complex) at 4.1 angstrom…
7A5P 5.0 Å, Human C Complex Spliceosome - Medium-resolution PERIPHERY

Browse structure collections

About this viewer

MolViewer shows 2A2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.