2ADO: Mediator of DNA damage checkpoint protein 1

Crystal Structure Of The Brct Repeat Region From The Mediator of DNA damage checkpoint protein 1, MDC1. Determined by X-ray diffraction at 1.45 Å resolution. Released 2 Aug 2005.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,255
Mol. weight: 43.02 kDa
Released: 2 Aug 2005

Explore 2ADO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ADO contains 25 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1897	4	1
α-helix	1903-1911	9
β-strand	1915-1916	2	1
β-strand	1925-1927	3	1
α-helix	1935-1943	9
β-strand	1947-1948	2	1
α-helix	1951-1959	9
α-helix	1962-1964	3
α-helix	1966-1968	3
β-strand	1969	1	1
α-helix	1973-1979	7
α-helix	1983-1992	10
β-strand	2000-2003	4	2
α-helix	2011-2020	10
β-strand	2024-2025	2	2
β-strand	2037-2040	4	2
α-helix	2043-2048	6
α-helix	2050-2055	6
α-helix	2057-2058	2
β-strand	2059-2060	2	2
α-helix	2062-2071	10
α-helix	2076-2078	3
β-strand	2080	1	2

Chain B: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1897	4	3
α-helix	1903-1911	9
β-strand	1915-1916	2	3
β-strand	1925-1927	3	3
α-helix	1935-1943	9
β-strand	1947-1948	2	3
α-helix	1951-1959	9
α-helix	1962-1964	3
α-helix	1966-1968	3
β-strand	1969	1	3
α-helix	1973-1979	7
α-helix	1983-1992	10
β-strand	2000-2003	4	4
α-helix	2011-2020	10
β-strand	2024-2025	2	4
β-strand	2037-2040	4	4
α-helix	2043-2048	6
α-helix	2050-2055	6
β-strand	2059-2060	2	4
α-helix	2062-2071	10
α-helix	2076-2079	4
β-strand	2080	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of DNA damage checkpoint protein 1	A, B	protein	196	Homo sapiens	Q14676 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2ADO_1 Mediator of DNA damage checkpoint protein 1 (chains A, B)
TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSL
DWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPP
PPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVL
KQEAKPEAFVLSPLEM

Primary citation

Structure of the BRCT Repeat Domain of MDC1 and Its Specificity for the Free COOH-terminal End of the {gamma}-H2AX Histone Tail. Lee, M.S., Edwards, R.A., Thede, G.L. et al. J Biol Chem (2005) 280:32053-32056. DOI 10.1074/jbc.C500273200 · PubMed

Other PDB entries of the same protein (UniProt Q14676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ETX 1.33 Å, Crystal Structure of MDC1 Tandem BRCT Domains
3K05 1.33 Å, The crystal structure of MDC1 BRCT T2067D in complex with a minimal recognition…
3UMZ 1.65 Å, Crystal Structure of the human MDC1 FHA Domain
3UNN 1.7 Å, Monomeric structure of the human MDC1 FHA domain in complex with an MDC1 phospho-T4…
3UNM 1.8 Å, Crystal Structure of The Human MDC1 FHA Domain
3UOT 1.8 Å, Crystal Structure of MDC1 FHA Domain in Complex with a Phosphorylated Peptide from the…
3UN0 2.3 Å, Crystal Structure of MDC1 FHA Domain
9QJZ 2.31 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide…
2AZM 2.41 Å, Crystal structure of the MDC1 brct repeat in complex with the histone tail of gamma-H2AX
9IF9 2.55 Å, Crystal structure of the Pellino 1 FHA domain in complex with a MDC1-TQxF phosphopeptide.
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide

Browse structure collections

About this viewer

MolViewer shows 2ADO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.