2AK5: Beta PIX-SH3

beta PIX-SH3 complexed with a Cbl-b peptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 11 Oct 2005.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Rattus norvegicus
Chains: 3
Atoms: 1,216
Mol. weight: 15.59 kDa
Released: 11 Oct 2005

Explore 2AK5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AK5 contains 4 α-helices and 16 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	1
β-strand	17	1	2
β-strand	24	1	1
β-strand	27	1	2
β-strand	32-37	6	1
β-strand	43-48	6	1
β-strand	51-56	6	1
α-helix	57-59	3
β-strand	60-62	3	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	10-13	4	3
β-strand	17	1	4
β-strand	24	1	3
β-strand	27	1	4
β-strand	32-37	6	3
β-strand	43-48	6	3
β-strand	51-56	6	3
α-helix	57-59	3
β-strand	60-62	3	3

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	905-910	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 7	A, B	protein	64	Rattus norvegicus	O55043 (AlphaFold model)
8-residue peptide from a signal transduction protein CBL-B	D	protein	8		Q13191 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AK5_1 Rho guanine nucleotide exchange factor 7 (chains A, B)
GSANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVRE
IKPS

Sequence of entity 2 (D), FASTA

>2AK5_2 8-residue peptide from a signal transduction protein CBL-B (chains D)
RPPKPRPR

Primary citation

Cbl promotes clustering of endocytic adaptor proteins. Jozic, D., Cardenes, N., Deribe, Y.L. et al. Nat Struct Mol Biol (2005) 12:972-979. DOI 10.1038/nsmb1000 · PubMed

Other PDB entries of the same protein (UniProt O55043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2G6F 0.92 Å, Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide…
2DF6 1.3 Å, Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide…
2P4R 2.0 Å, Structural basis for a novel interaction between AIP4 and beta-PIX
3QJN 2.71 Å, Structural flexibility of Shank PDZ domain is important for its binding to different…
2W6B 2.8 Å, Crystal Structure of the Trimeric beta-PIX Coiled-Coil Domain
3L4F 2.8 Å, Crystal Structure of betaPIX Coiled-Coil Domain and Shank PDZ Complex

Browse structure collections

About this viewer

MolViewer shows 2AK5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.